Details for Kale Locus Bo5g115520

Position : C5 ( 5`- 35474966 .. 35482415 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115520

Protein [Map View]
MFPWNFAEAAFSRWAVKRVVKFLLKKKLGKFILGDIDLDQLDIQLRDGTIQLSDLAINVDYFNDKFDAPLLIKEGSIGSL
LVKMPWKTNGCQVELDEVELVLAPRLESTSSSSNEPSTSSSARDDSRIGLGTHESEMLVNAAKSASVDVHEGVKTVAKIV
KWFLTSFHVKVKNLIIAFDPDFGEERNEAGGPRPKLVLRMAEIECGISEERVSTSEVSPDSFLGINRLRNCVKFQGAAVE
LLHMGDDDDDDDDGDMSNDVIMTGEGGGFSGSVNLSIPWKNGSLDIRKVDADISIDPVEVRFQPSTIGWFLRLWKNFSSF
GSDCCPSVSHSDLSLGSPAVPTNVMVTPPATSSLSGGQEGEPDITPELQFISDWFPSSFSKKEEDGEVDIGASVDQFFEC
FDAMRSYQSAFGSQGMWNWTSSVFTAINAASSLASGSLLLPSEQKHVETSCKVSFAGVSVVLFFQDENVWKDVSTGIHYL
GAELRDISVSFQVSPQNMRLEAEVNSVEIADYYQAGNVVDTANSEYQSGLIKDLQAKVQSTLPPSAWADMNAASEKLSEI
VSDGFLFRNKGSAVKTLLVIAAGGSGFQFTVNFQSSKANLRGSNSFSLSLPPTTLWLNLHSVEMLVNLFNDVSESIPVTS
HERNQVASSSKSERLRGSVSIGNARAILCFPISEGLCSSLGEHFIVVDLSSSLPSDKERRKEGSPGEKYFTSAARSICFS
VGDVSIYMVTSDHKDSESGGEFSAYSILLTNNRTSHQLSTIGMFWQDETIISPWLVERAKMLATQEESIQTDKSRKNGLE
FAAVATAKDQEDIYSQTRKEIFLASSFCLCVHLLPLTIRLDSWQYSKLCNLIDQAKNWLSRMVANTSEKQEERAFKKIEE
SVVCQACLVVECDSVDIFVRPEPRMDIKNQLQIELPGSWIQLNLNVQKLNLMSVSNLGSISGADLFWLAHGEGTLWGSVT
GLHDQELQLISCSNSAIKRGNGGGSNALSSRLAGLDILNLHEPGACYDYLAISVRGCTISAVGGRLDWIDVASSFFTSQV
ETNSEERNSSSSSSSSFTLNLVDVGISYEPHHENTDHLHQSSDPWVACLVAASSFSLSKTSLVDSIRNDYRIRIQDLGLL
LSLDLDLRRLDGTYSSANLHKTGYVKVATEALIEATLRTNSESGLLWELECSKSHLLIETCSDTTSGLIRLATQLQQLFA
PDLEESAVHLQTRWDNIQQANARNGFDISDTLSSSGSSGEIKNLRFGSETETGIIGLMGEINEDAFQFDVNPSSQSDSFE
SQNNYMSPYGHAPNWVPATPEEPPSNQFIGESSSRLKPESSQIFLERDGLPEIIEDYCFSEFHPLSEVPQEGDSSGRQVF
LETDLSRGNSGWYDDTSIRILEDHVSEATEEDHEEHMLDGDFSSFGLTSHSTVTANGRVILKNIDIKWRIYSGSDWHDSG
KKSEVHKSIVGRDTSSCLELELSGVQCLYEIFPIGGTCTSKLCLMVQEFYLYDRSKDAPWRTVLGYYNSKDHPRDSSANA
IKVELKAVRPDPDTPLEENRLRVALLPILLHLHQSQLDFLISFFGANNLEKPVVSVGDSGGSALSVSVNGHNIIEEALLP
YFQKFDIWPVTVRVDYSPHHVDLAALTGGKYAELVNLVPWKGIELKLKHVHAAGIYGWGNVCETVVGEWLEDISQNQIHQ
LLKGIPTVRSLSALYAAATKLVSSPVQSYRKDRRLVKGVQRGTIAFLRSISLEAVGLGVHLAAGAHDILLRAEYILASAP
SSPQPQGKMKTNVRHNQPRNAKQGMRQACENIGDGIGKTASALVRTPLKKYQRGDGAGSTFVTVVQGVPTAAIAPASACV
RAVHSALVGIRNSLDPEHKKESMEKYLGPDKQRKQDQHR*

DNA
ATGTTTCCATGGAACTTCGCGGAGGCTGCTTTCTCAAGGTGGGCCGTGAAGAGGGTCGTCAAATTCTTATTGAAGAAGAA
ACTCGGCAAATTCATACTCGGCGATATCGACCTCGATCAGCTCGATATCCAGCTTAGGGATGGCACAATCCAGCTCTCCG
ATCTCGCTATCAACGTTGACTATTTCAATGACAAGTTTGATGCTCCGCTGCTCATAAAGGAAGGTTCGATTGGTTCTTTG
TTAGTTAAGATGCCTTGGAAGACTAATGGTTGTCAAGTTGAGCTAGACGAGGTCGAGCTTGTTCTTGCGCCACGTTTGGA
GAGTACTTCTTCTTCTTCAAATGAGCCCAGCACCTCCTCTTCTGCTAGGGATGATTCACGTATTGGACTAGGAACTCATG
AGAGTGAGATGTTGGTGAACGCTGCTAAGTCTGCCTCTGTTGATGTTCATGAAGGAGTTAAGACTGTTGCGAAGATAGTT
AAATGGTTTCTTACGAGCTTCCATGTCAAAGTTAAGAATTTGATCATAGCGTTTGATCCTGATTTTGGCGAAGAACGGAA
TGAAGCTGGTGGTCCACGGCCAAAATTGGTGCTTAGAATGGCGGAGATAGAGTGTGGAATTTCAGAGGAGAGAGTTTCGA
CTAGTGAAGTGTCCCCTGATAGTTTCCTCGGTATTAATCGACTGAGAAACTGTGTGAAGTTTCAAGGAGCAGCTGTAGAG
CTTTTACATATGGGTGATGATGATGATGATGATGATGATGGCGACATGTCAAATGATGTGATCATGACAGGCGAAGGAGG
TGGCTTTTCAGGGAGTGTGAATTTGAGTATACCTTGGAAGAATGGTTCCTTAGACATTCGCAAAGTGGATGCTGATATTT
CTATTGATCCTGTTGAAGTGCGGTTTCAACCTTCTACAATTGGATGGTTCTTGCGGTTGTGGAAGAATTTCAGTAGTTTC
GGATCAGACTGTTGTCCTTCAGTTTCGCATTCTGATTTATCGTTGGGTTCACCTGCGGTACCTACTAATGTAATGGTAAC
GCCTCCAGCTACGTCATCCTTGTCAGGTGGACAAGAAGGCGAGCCGGATATTACTCCTGAGTTACAGTTCATATCAGATT
GGTTCCCGTCTTCCTTCAGTAAGAAAGAAGAGGATGGAGAAGTTGATATTGGTGCAAGTGTGGACCAGTTCTTTGAATGT
TTTGATGCAATGAGGAGTTACCAATCAGCTTTTGGAAGCCAAGGAATGTGGAATTGGACATCCTCTGTTTTCACAGCTAT
CAATGCGGCATCTAGCCTTGCTTCTGGGTCTTTACTTCTTCCTTCTGAACAGAAGCACGTTGAAACTAGTTGTAAGGTAT
CCTTTGCTGGAGTTTCGGTGGTACTGTTTTTCCAAGATGAAAACGTTTGGAAGGATGTTTCCACGGGGATTCACTACTTA
GGCGCAGAACTCAGAGATATTTCTGTGTCTTTTCAGGTATCCCCTCAGAATATGAGGTTAGAAGCAGAAGTGAACAGCGT
GGAGATCGCTGATTATTATCAAGCTGGAAATGTTGTTGACACCGCTAATTCTGAATATCAGAGTGGTTTGATTAAGGATT
TACAAGCCAAAGTTCAGAGTACACTTCCTCCCTCTGCCTGGGCTGATATGAATGCTGCTTCCGAAAAATTAAGCGAGATA
GTTTCTGATGGCTTCCTCTTTCGTAACAAGGGTTCTGCAGTCAAGACATTGTTAGTTATAGCTGCAGGGGGGAGTGGATT
TCAGTTTACTGTCAATTTCCAATCATCCAAAGCCAACCTTAGAGGATCAAACTCATTCTCGCTGAGTTTGCCACCTACCA
CACTCTGGTTGAACCTTCATTCAGTAGAAATGTTGGTAAATCTCTTCAACGATGTGTCAGAATCTATCCCCGTAACTAGT
CATGAAAGGAATCAGGTTGCATCCTCTTCTAAATCAGAAAGATTGCGAGGTAGCGTGTCAATCGGGAATGCTCGAGCGAT
TTTGTGCTTCCCCATTTCAGAAGGGTTGTGTAGCTCGCTTGGCGAACATTTTATTGTAGTCGACTTATCTTCCTCTCTAC
CTTCTGACAAGGAAAGGCGTAAGGAAGGAAGTCCAGGGGAGAAGTACTTTACATCGGCTGCTCGCTCCATATGCTTCAGT
GTTGGAGATGTTAGCATTTATATGGTCACTTCTGACCATAAAGATTCTGAATCAGGGGGTGAATTCTCTGCATATAGTAT
TTTACTTACCAACAATAGAACTAGTCACCAACTTTCAACTATTGGTATGTTTTGGCAAGATGAAACTATCATTAGCCCTT
GGTTAGTGGAGAGAGCTAAGATGCTGGCTACGCAGGAAGAATCTATTCAAACAGATAAATCTAGGAAGAACGGCCTTGAG
TTTGCTGCTGTTGCTACTGCCAAAGATCAAGAAGACATCTACTCTCAAACCAGGAAAGAGATATTTTTGGCTTCTTCATT
CTGCCTCTGCGTTCATTTGCTTCCACTTACCATCCGGTTAGATAGTTGGCAATACAGCAAGTTATGTAATCTCATAGATC
AGGCAAAAAATTGGCTATCACGTATGGTAGCCAATACAAGTGAGAAACAAGAGGAACGTGCCTTTAAGAAAATAGAGGAA
TCTGTTGTGTGTCAAGCGTGTCTGGTTGTGGAATGTGATTCTGTTGACATCTTCGTTAGGCCAGAACCTCGAATGGACAT
TAAAAATCAACTTCAGATTGAGCTTCCAGGATCATGGATTCAGTTAAACCTGAACGTTCAAAAATTAAATCTTATGTCTG
TCTCAAATCTTGGCAGTATCTCTGGTGCTGATTTATTTTGGTTAGCCCATGGGGAAGGCACCCTATGGGGCTCTGTCACC
GGTCTACATGATCAAGAGCTGCAATTAATCTCGTGTAGCAACTCTGCCATCAAGCGCGGTAATGGAGGAGGTTCAAATGC
ATTATCGTCAAGGTTGGCTGGCTTAGATATTCTGAACTTACATGAGCCTGGGGCCTGTTACGATTATTTAGCAATATCTG
TCAGGGGCTGTACGATTTCTGCCGTAGGGGGACGCCTGGATTGGATAGATGTGGCTTCTTCTTTTTTCACTTCTCAAGTT
GAGACAAATTCTGAAGAGAGAAACTCCAGCTCATCTAGTAGCTCCTCGTTTACTCTTAATTTGGTTGATGTTGGTATAAG
CTATGAGCCCCACCACGAGAATACAGATCATTTACATCAATCAAGTGATCCGTGGGTGGCCTGTCTGGTAGCGGCATCTT
CTTTTAGCCTTTCAAAGACAAGTCTGGTTGATTCCATAAGAAATGACTACAGAATCAGGATTCAAGATCTTGGGCTTCTC
CTGTCCTTGGATTTAGACCTTAGAAGACTTGATGGAACGTACAGTTCAGCTAATCTTCATAAGACTGGCTATGTTAAAGT
TGCTACTGAAGCTTTAATTGAAGCAACTCTAAGGACAAACTCTGAAAGTGGCCTTCTCTGGGAGTTAGAGTGTTCAAAAT
CTCACTTGTTAATTGAAACTTGCAGTGACACAACCTCTGGTTTGATTCGCTTGGCCACGCAGCTCCAACAGTTGTTTGCT
CCTGATTTGGAGGAATCAGCTGTGCACTTGCAGACTCGATGGGACAACATTCAGCAAGCGAATGCTAGGAATGGTTTTGA
CATCAGCGATACACTCAGTAGCTCTGGTTCAAGTGGAGAAATTAAAAACCTAAGATTTGGCTCCGAAACTGAAACAGGAA
TCATTGGTTTGATGGGCGAAATAAATGAAGATGCTTTCCAATTTGATGTCAATCCTAGTAGTCAGTCCGACTCTTTCGAA
TCTCAGAATAACTATATGTCCCCTTATGGGCATGCACCTAACTGGGTACCTGCTACTCCTGAGGAACCACCTTCTAATCA
GTTCATTGGTGAGTCATCGTCCAGATTGAAACCAGAAAGCAGCCAAATATTCCTTGAAAGAGATGGCCTACCTGAAATTA
TTGAAGACTATTGTTTTTCCGAGTTCCATCCCTTGTCAGAGGTACCTCAAGAAGGGGATTCATCTGGGAGACAAGTGTTT
CTTGAGACTGATTTGAGTAGAGGAAACTCTGGGTGGTATGATGACACTTCCATAAGAATTTTAGAAGACCATGTGTCAGA
AGCAACTGAGGAAGATCATGAGGAACATATGCTGGATGGAGATTTTTCATCTTTTGGCCTGACGTCTCATTCTACAGTAA
CAGCTAATGGACGTGTAATTCTGAAAAACATCGACATCAAATGGAGGATTTACTCTGGCTCTGATTGGCATGATTCTGGA
AAGAAAAGTGAAGTTCATAAAAGTATAGTGGGCCGGGATACAAGTTCTTGCCTTGAGCTGGAACTATCTGGGGTGCAGTG
CCTATATGAGATCTTCCCAATTGGTGGAACATGCACCTCTAAGCTATGCCTCATGGTCCAAGAATTTTATCTTTATGATA
GAAGCAAAGATGCACCATGGAGAACGGTGCTTGGATATTACAACTCAAAAGATCACCCAAGAGATTCGTCTGCAAATGCA
ATCAAGGTTGAATTAAAAGCTGTCAGACCTGACCCTGACACGCCACTTGAGGAAAACCGGTTACGTGTTGCTTTACTCCC
TATACTGTTGCATCTTCATCAAAGTCAACTGGATTTTCTCATCAGCTTTTTTGGAGCTAACAACCTAGAAAAGCCTGTTG
TTTCCGTCGGAGACTCAGGTGGTTCAGCGTTGTCGGTTTCTGTTAACGGACATAATATCATAGAAGAAGCGCTTCTTCCA
TATTTTCAGAAATTCGACATATGGCCTGTTACTGTTCGAGTTGACTACAGTCCACATCATGTTGATCTAGCAGCACTAAC
TGGAGGGAAATATGCAGAGCTAGTGAACCTTGTTCCCTGGAAGGGTATTGAACTAAAGCTCAAACATGTGCATGCTGCTG
GAATCTACGGCTGGGGTAATGTATGCGAGACTGTAGTGGGAGAGTGGTTGGAAGATATATCTCAGAATCAGATTCATCAA
CTGTTGAAGGGTATCCCAACAGTAAGATCACTTTCTGCTCTTTATGCTGCTGCTACGAAGCTAGTCTCTTCACCTGTTCA
AAGTTACAGAAAAGATCGAAGGCTAGTAAAGGGAGTCCAAAGAGGTACTATTGCGTTTCTGAGAAGCATCTCACTGGAAG
CCGTTGGACTTGGTGTTCACTTGGCAGCCGGGGCTCATGATATTTTGTTGAGAGCAGAATATATATTAGCAAGTGCACCA
TCATCGCCACAGCCCCAGGGCAAAATGAAGACGAATGTTAGACATAATCAGCCGAGAAACGCTAAGCAAGGCATGCGTCA
GGCATGCGAGAACATCGGTGATGGAATAGGAAAGACGGCTTCTGCATTAGTCCGCACGCCTTTAAAAAAGTATCAACGTG
GAGACGGAGCTGGATCAACATTTGTAACAGTTGTTCAGGGAGTTCCAACAGCTGCTATAGCACCTGCTTCAGCTTGTGTT
AGGGCGGTACATAGCGCTCTTGTTGGCATCAGAAATAGTCTTGATCCTGAACATAAAAAGGAATCCATGGAGAAGTACTT
AGGACCAGATAAGCAAAGGAAACAAGACCAACATAGATAA