Details for Kale Locus Bo5g115510

Position : C5 ( 5`- 35471872 .. 35472430 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115510

Protein [Map View]
MANTAEQDAMYPSFVDARISFSNDFADSDHLTLHQTISSRKDQMKYKEAPVSSDFKFNVENYGFISAADEIFFGGVLLPL
EKTRQRKVTTLREELSVQDSDRTNSKGSRNWWKLGLSNPKKIHSKNNNNNFHLPHKSQNCLASILESDD*

DNA
ATGGCTAATACTGCAGAACAAGACGCAATGTATCCATCCTTTGTAGACGCAAGAATTTCATTCTCCAATGATTTTGCAGA
CAGTGATCATCTGACGCTTCATCAGACAATTTCATCAAGAAAGGATCAGATGAAGTACAAGGAAGCTCCTGTTTCGTCTG
ATTTCAAATTCAATGTCGAAAACTACGGTTTTATATCTGCGGCTGATGAGATCTTCTTTGGTGGAGTTTTGTTGCCATTG
GAGAAGACTCGTCAGCGAAAAGTGACCACACTTAGAGAAGAGCTAAGCGTTCAAGATTCTGACCGTACGAACTCAAAGGG
ATCTCGTAATTGGTGGAAACTAGGTCTAAGTAATCCCAAGAAAATTCACTCCAAGAACAACAACAACAACTTCCACCTTC
CCCACAAATCTCAGAATTGTCTTGCGAGTATATTGGAATCTGATGACTGA