Details for Kale Locus Bo5g115500

Position : C5 ( 5`- 35453170 .. 35459190 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115500

Protein [Map View]
MEEEDQVVISSSDSEDSSDSYEEESQDSEGEYENSDCEDLAAVSPPSDADRKFKNVNDLLRGNLVVQRQPLLPRVLSVSE
GAAVCRKPFKPPCSHGYNTTGQLSRRLSARKRFVPWGSSSPVVVVLPTKLNESTTIEKDEEEEVVSLPPEVEPLVLWQLD
ESDDAMRISVHPLLVRFLRPHQREGVQFMFDCVSGLHGSENINGCILADDMGLGKTLQSITLLYTLLCQGFDGTPMVKKA
IIVTPTSLVSNWEAEIKKWVGDRIQLIALCESTRDDVLSGIDSFTRPRSALQVLIISYETFRMHSSKFGQTGSCDLLICD
EAHRLKNDQTLTNKALASLTCKRRVLLSGTPMQNDLEEFFAMVNFTNPGSLGDAAHFRHYFEAPIICGREPTATEEEKNL
AAARSTELSSKVNQFILRRTNALLSNHLPPKIIEVVCCKMTTLQSTLYNHFISSKNLKRALADNAKQTKVLAYITALKKL
CNHPKLIYDTIKSKSPGTIGFEDCLEFFPAEMFSGRSGAWTGGDGAWVELSGKMHVLSRLLANLRRNTDDRIVLVSNYTQ
TLDLFAQLCRERRYPYLRLDGSTSISKRQKLVNRLNDPTKDEFAFLLSSKAGGCGLNLIGANRLVLFDPDWNPANDKQAA
ARVWRDGQKKRVYVYRFLSTGTIEEKVYQRQMSKEGLQKVIQHEQTDNSTRQGNLLSTEDLRDLFSFHGDVRSEIHGKMS
CSRCQNDASGTENTEEGNENNLDDSACQTDQEDIGGFANDAGCLHSLKISERQVGTPLEEDLASWGHHFTSKSVPDTILQ
ASAGDEVTFVFTNQVDGKLIPIKSNPSPKPEVTELNRNQAVSNRGFNKPQQRPREPLQPLSPNETNKRVKLSTYKRLHCT
SNTDGAQMQMPLQRPNQVSVNHDDDFV*

DNA
ATGGAGGAAGAAGACCAAGTCGTCATCTCGTCTTCCGATTCCGAAGATTCCAGCGACAGTTACGAAGAAGAGTCTCAAGA
CTCGGAGGGAGAATACGAAAATTCCGACTGCGAAGACCTTGCCGCCGTTTCTCCTCCATCCGACGCCGATCGGAAATTCA
AGAACGTAAATGATCTATTGAGGGGAAATCTGGTGGTGCAACGGCAGCCACTCCTTCCTCGGGTGCTTTCAGTCTCTGAA
GGAGCTGCAGTTTGTAGGAAGCCTTTCAAGCCTCCGTGTTCTCATGGTTATAATACCACCGGTCAACTTTCTCGTCGCCT
TTCGGCTCGGAAACGCTTTGTTCCTTGGGGTTCTTCAAGTCCAGTTGTGGTTGTTCTGCCTACTAAGCTGAATGAATCAA
CCACTATTGAAAAAGATGAAGAAGAGGAAGTTGTTTCTCTTCCACCTGAAGTTGAACCCTTGGTATTGTGGCAACTTGAT
GAATCTGATGATGCCATGAGAATTTCGGTGCATCCATTGCTTGTCCGGTTTCTTCGGCCTCATCAAAGAGAAGGTGTCCA
GTTCATGTTTGATTGTGTTTCAGGATTACATGGTTCGGAAAATATAAATGGTTGCATTCTGGCTGACGACATGGGTTTGG
GGAAGACATTGCAGTCCATTACTTTACTATACACACTTCTATGTCAAGGATTTGATGGGACTCCTATGGTTAAAAAGGCC
ATTATTGTTACACCAACGAGTCTTGTCAGTAACTGGGAAGCTGAAATTAAGAAATGGGTTGGAGACAGGATTCAGCTTAT
AGCTCTCTGTGAAAGCACCAGAGATGATGTTTTGTCTGGAATAGATAGTTTCACTCGACCACGAAGCGCTTTGCAGGTAC
TTATTATTTCTTACGAGACATTTCGAATGCACTCATCCAAGTTCGGCCAGACTGGATCCTGTGATCTTCTAATATGCGAT
GAGGCTCATAGGTTGAAAAATGACCAGACACTAACTAACAAGGCTTTGGCTTCATTGACATGCAAAAGGCGGGTTTTGTT
GTCTGGAACTCCCATGCAGAATGACTTGGAAGAGTTTTTCGCCATGGTCAACTTTACAAATCCAGGAAGTTTAGGCGATG
CTGCGCATTTTCGCCACTATTTTGAGGCACCTATTATATGTGGAAGAGAACCTACAGCTACTGAGGAAGAGAAAAATTTA
GCTGCTGCCCGCTCGACAGAACTGAGTTCAAAAGTGAATCAGTTTATATTGAGGAGAACTAATGCATTACTCTCCAATCA
TTTACCACCTAAGATAATTGAAGTAGTTTGTTGCAAGATGACTACTCTCCAGTCCACTTTGTACAATCATTTTATAAGCT
CAAAAAATCTTAAAAGAGCACTTGCTGATAATGCAAAGCAGACAAAAGTTTTGGCTTATATAACAGCTCTCAAGAAGCTC
TGCAATCATCCAAAGCTAATTTACGATACAATAAAAAGCAAAAGTCCTGGTACTATTGGTTTTGAGGATTGCTTAGAGTT
TTTCCCTGCAGAAATGTTCTCCGGGAGATCTGGAGCATGGACCGGGGGTGATGGTGCCTGGGTCGAGCTCTCTGGGAAAA
TGCATGTTCTCTCCAGACTTTTGGCTAACCTACGTCGGAATACTGATGACCGCATAGTCCTTGTATCAAACTATACGCAG
ACATTGGATCTTTTCGCTCAACTCTGTCGCGAAAGAAGATATCCTTATCTGAGGCTGGATGGATCAACATCTATCAGCAA
GAGGCAGAAGCTTGTTAACCGGTTGAACGACCCAACAAAGGATGAATTTGCATTTCTCTTAAGCAGCAAGGCAGGTGGCT
GTGGATTAAATTTAATTGGTGCTAATCGACTTGTTTTGTTCGATCCCGATTGGAATCCTGCCAATGATAAACAAGCTGCT
GCTAGAGTTTGGAGGGATGGGCAAAAGAAAAGAGTGTATGTCTACAGGTTTCTTAGTACTGGAACTATTGAAGAAAAGGT
TTACCAGCGTCAGATGTCAAAAGAAGGGCTTCAAAAAGTTATTCAGCATGAACAGACGGATAACAGCACTAGACAGGGAA
ACTTACTTTCAACAGAGGATTTAAGAGACTTATTTTCCTTCCACGGGGATGTTAGGTCTGAAATCCATGGAAAGATGAGC
TGCAGCAGGTGCCAAAATGATGCCTCTGGTACAGAAAATACGGAAGAAGGAAATGAGAACAATCTTGATGACAGTGCTTG
CCAGACTGATCAAGAAGATATAGGCGGATTTGCAAACGATGCAGGATGCCTTCACTCGTTGAAAATCTCCGAGAGACAGG
TGGGCACTCCATTGGAGGAAGATCTAGCAAGCTGGGGTCATCATTTTACCTCAAAGTCTGTTCCAGATACTATACTGCAA
GCTTCAGCTGGTGACGAGGTTACATTTGTATTCACAAACCAGGTAGATGGGAAGCTCATTCCCATCAAATCAAATCCTAG
TCCAAAACCGGAAGTAACCGAATTAAACCGAAACCAAGCTGTAAGTAACCGTGGCTTCAACAAACCGCAACAAAGACCTA
GGGAACCGCTCCAACCACTATCTCCCAACGAGACCAACAAAAGAGTGAAGTTGTCTACGTATAAGCGTTTACACTGTACT
AGTAACACTGATGGTGCTCAAATGCAAATGCCTTTGCAGAGACCAAATCAAGTGTCTGTAAATCACGATGATGATTTTGT
ATGA