Details for Kale Locus Bo5g115490

Position : C5 ( 5`- 35451445 .. 35452781 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115490

Protein [Map View]
MFRLYPNCSLPSLVFLPRHPPRSFRCRATADIPLGDGIGVPREPDSTSDTARSRDVSAAAGGNVESGKWRKRRLLWSKSG
VSYLVGDDDALPLPMTYPNTSPVSPDEIDRRLQCDPVVEDCKEVVYEWTGKCRSCQGSGSVSYYKKRGKEVICKCIPCQG
IGYVQKITSRTDIDVMEDLDNEAS*

DNA
ATGTTCCGATTATACCCAAACTGCTCTCTACCTTCTCTCGTCTTCCTTCCCCGCCATCCTCCTCGCTCCTTCCGTTGCCG
CGCCACCGCCGATATCCCTCTAGGCGACGGAATCGGAGTACCACGTGAACCGGATTCAACCTCTGACACGGCGAGGTCTC
GAGATGTCTCCGCCGCGGCCGGAGGGAACGTTGAATCGGGTAAGTGGAGGAAAAGGAGGCTGCTGTGGTCGAAAAGCGGA
GTGAGTTACTTGGTAGGCGACGACGACGCGCTTCCGTTGCCTATGACTTATCCCAATACATCCCCTGTGTCGCCCGATGA
GATTGACCGGAGGTTGCAGTGCGATCCTGTTGTCGAGGATTGCAAGGAAGTGGTTTATGAGTGGACTGGCAAGTGTAGAA
GTTGCCAAGGATCTGGATCTGTCAGCTATTACAAGAAAAGGGGTAAAGAGGTTATCTGCAAATGCATACCTTGCCAAGGG
ATAGGATATGTGCAGAAGATAACATCTCGAACGGACATTGATGTGATGGAAGATTTGGATAACGAAGCATCTTGA