Details for Kale Locus Bo5g115480

Position : C5 ( 5`- 35448527 .. 35450020 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115480

Protein [Map View]
MLPFFFFLLLTFSISQALPPPRGFYLNCGSPYTTKLNEINYTSDRGFINVGNTTAIKQKDLLPILSTLRYFPDKSSRKHC
YNFPVAKNSKYLIRTTYYYGNFDGKNSPPVFDQIIGGTKWSVVNTSEDYSKGQSSYYEIVVGVPGRTLSVCLAKNAKTLS
SPFISALDVQSLEDTMYNSTDLGLYKLSLIARNSFGVDGDMISYPDDQYNRLWQPFSDKKHQTVTSQSSVNPLDFWNIPP
AKAFMEGFTVTKGKALELQWPPFPLPATKYYIALYFQDDRSPSPLSWRAFGASINGATFSRKLNVSTNGVMVYSGQWPLS
GQTTITLTTAKGSPMGAVINAGEVFQVIPIGGATNISDVTALEDLLESIDEPPVDWSGDPCLPLPNSWTGVTCSKEKINK
VISL*

DNA
ATGCTTCCTTTCTTCTTCTTCCTCTTATTAACGTTCTCTATCTCTCAAGCTCTCCCTCCTCCTAGAGGTTTTTACTTAAA
CTGTGGATCACCTTACACAACGAAACTCAACGAGATAAACTACACATCGGACAGAGGATTCATCAACGTAGGAAACACGA
CAGCAATAAAACAAAAAGACCTTCTCCCAATCCTCTCGACACTGCGTTACTTCCCAGACAAGTCATCACGAAAACACTGT
TATAACTTCCCTGTCGCCAAGAACTCCAAGTACCTTATCCGAACCACTTACTACTACGGCAACTTCGACGGTAAAAACAG
CCCGCCGGTGTTCGATCAGATCATCGGAGGCACAAAATGGAGCGTTGTGAATACATCAGAGGATTACTCCAAGGGCCAGA
GTTCTTATTACGAGATCGTTGTTGGTGTTCCTGGGAGGACACTAAGTGTTTGTTTAGCTAAGAATGCAAAGACTCTCTCG
TCACCTTTTATATCGGCTTTAGATGTGCAATCTCTTGAGGATACAATGTATAACTCAACTGATCTTGGGTTATACAAGCT
CAGCCTCATCGCTAGGAACAGCTTTGGAGTAGATGGAGATATGATTAGCTATCCAGATGACCAATATAACCGTCTATGGC
AACCGTTTTCAGACAAGAAGCATCAGACGGTGACTTCTCAAAGCAGTGTTAACCCATTAGACTTCTGGAACATTCCACCT
GCTAAAGCTTTCATGGAAGGCTTCACAGTGACTAAAGGGAAGGCTCTAGAGCTTCAATGGCCGCCGTTTCCTCTTCCAGC
CACAAAGTACTATATAGCTCTGTATTTTCAGGATGATAGGAGTCCAAGCCCCTTGAGCTGGAGAGCCTTTGGTGCATCAA
TCAATGGAGCTACCTTTTCAAGAAAACTCAACGTGAGTACCAATGGGGTTATGGTTTACTCAGGTCAGTGGCCATTGTCA
GGTCAGACTACGATCACGTTGACTACTGCTAAAGGTTCACCTATGGGAGCAGTGATCAATGCTGGAGAAGTGTTTCAGGT
TATTCCCATAGGTGGAGCCACTAATATAAGCGATGTTACTGCGTTGGAAGATTTGTTAGAGAGCATCGACGAGCCTCCTG
TAGATTGGTCCGGTGATCCATGCCTTCCTCTTCCCAACTCGTGGACTGGTGTAACTTGCTCCAAAGAAAAAATCAACAAA
GTGATTTCTCTGTAA