Details for Kale Locus Bo5g115450

Position : C5 ( 5`- 35437949 .. 35439969 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115450

Protein [Map View]
MGTSQSREDRISDSDTDTDSDSDYYHEEEDDDQHGDTDVSKKQGSSSASGSKLSSDSSTHEIEQKLSALKLKYPSSSSET
PKIKNAVKLYRHIGGNTPKAKWITAEKLTSYKFVKTSSLEGEDLDDYDDGEESNEKGESFWFLGVGSKVKARVSSDMQLK
MFADQRRVDFVSNGVWALKFLTDEDYRRFVTRFQDYLFENVFMIKASEESKMKVYGKDFIGWANPEAADDSMWEDAEGPP
EEEEEVDEKDRDLTEEFEEVANGGVQSLALGALENSFLVNDSGVQVYRNMDRGIHGKGVCVRFDGGRPGSSSQTTPNKAL
LMRAETNMMLMSPANQGKPNTSGVKQLDIESGKIVTEWKFKKDGTEITMRDITNDTKGSQLDPSESTFLGLDDNRLCQWD
MRDKRGIVQNIDSPVLEWTQGHQFSRGTNFQCFASTGDGSIVVGSRDGKIRLYSKTSMRMAKTAFPGLGSPVTHVDVSYD
GKWILGTTDTYLVLICTLFNDKDGRTKTGFSGRMGNKIPAPRLLKLTPLDSHLAGKDNKFHGAHFSWVTESGKQERHIVA
TVGKFSVIWDLERVKNSAHECYRNQQGLKSCYCYKILLKDESIVESRFMHDRFSFSGNKSPEAPLVVATPQKVSSISLSG
RRL*

DNA
ATGGGTACTTCTCAGAGTCGCGAAGATCGGATCTCCGATTCCGATACTGATACTGATTCTGATTCAGACTACTACCACGA
AGAAGAAGATGATGATCAGCACGGAGACACCGACGTCTCGAAAAAGCAAGGATCTTCGTCCGCCTCTGGTTCGAAACTCT
CTTCCGATTCATCGACTCACGAAATCGAGCAGAAGCTGAGCGCCTTGAAGCTGAAATACCCATCATCATCATCGGAAACC
CCCAAGATCAAAAACGCGGTGAAGCTTTACCGCCACATCGGTGGAAACACGCCCAAGGCGAAATGGATCACCGCTGAGAA
ACTCACATCTTACAAGTTCGTCAAAACGTCGTCGTTAGAAGGAGAGGACCTTGATGATTACGACGACGGTGAAGAATCAA
ACGAGAAAGGTGAGTCCTTTTGGTTTCTCGGCGTCGGTTCCAAGGTCAAAGCTAGGGTTTCGAGTGATATGCAGTTGAAG
ATGTTTGCGGATCAGCGTAGGGTTGATTTCGTGAGTAACGGTGTCTGGGCTTTGAAGTTCTTGACGGATGAGGATTACAG
GAGGTTCGTTACTAGGTTCCAGGACTATCTCTTTGAGAATGTGTTTATGATTAAAGCCTCTGAGGAGAGTAAGATGAAAG
TTTATGGGAAGGATTTCATCGGTTGGGCTAACCCTGAAGCTGCTGATGATTCCATGTGGGAGGACGCTGAAGGTCCACCT
GAGGAGGAGGAGGAAGTTGATGAGAAAGATAGGGACTTGACTGAAGAGTTTGAAGAGGTGGCTAACGGTGGAGTGCAGAG
TTTGGCTTTAGGAGCTTTGGAGAATTCGTTTCTTGTGAATGATTCAGGTGTTCAGGTTTACAGGAATATGGACCGTGGGA
TTCATGGGAAAGGCGTGTGCGTTAGGTTTGATGGTGGAAGACCTGGTTCGTCAAGCCAGACGACACCTAACAAGGCGCTT
TTGATGAGGGCGGAGACTAATATGATGCTGATGAGTCCTGCTAACCAAGGGAAGCCAAACACGAGCGGTGTGAAGCAGCT
TGATATCGAGTCGGGGAAGATTGTCACGGAATGGAAGTTTAAGAAAGACGGGACTGAGATCACGATGAGAGACATAACGA
ATGATACTAAAGGCTCGCAGCTAGATCCATCAGAGTCCACGTTTTTGGGGTTGGATGATAATAGGTTGTGTCAGTGGGAC
ATGAGGGACAAGAGGGGTATAGTGCAGAACATCGACTCGCCCGTTTTGGAATGGACTCAAGGGCATCAGTTTTCTAGAGG
AACTAACTTCCAGTGCTTTGCTAGTACTGGAGATGGGTCGATCGTTGTGGGATCGCGTGATGGGAAGATAAGGTTGTACT
CGAAGACCTCTATGAGAATGGCTAAGACTGCCTTCCCAGGGCTTGGTTCGCCGGTGACACATGTGGACGTGTCTTATGAT
GGGAAATGGATCTTGGGGACGACAGATACGTACTTGGTTCTTATATGCACCCTTTTCAATGACAAAGATGGTCGGACCAA
AACAGGTTTTAGCGGAAGGATGGGGAACAAGATACCAGCTCCTAGGCTGCTGAAGCTAACGCCATTAGATTCACACTTGG
CAGGGAAAGATAACAAGTTTCACGGCGCGCACTTCTCATGGGTAACTGAGAGCGGGAAGCAAGAGAGGCACATCGTAGCA
ACAGTGGGGAAGTTCAGTGTGATATGGGACTTGGAACGGGTGAAGAACAGTGCGCACGAGTGCTATAGGAACCAGCAAGG
GCTTAAGAGCTGTTACTGCTACAAGATCTTGTTGAAGGATGAGTCAATCGTTGAGAGCCGTTTCATGCACGATAGATTCT
CTTTCTCTGGTAACAAATCTCCAGAAGCTCCACTTGTGGTTGCCACTCCTCAGAAAGTCAGCTCCATTAGCCTCTCTGGG
AGACGATTGTGA