Details for Kale Locus Bo5g115360

Position : C5 ( 5`- 35370343 .. 35372011 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115360

Protein [Map View]
MESLYSSGGVRNLEASIAAWNFQIAVYFAFGFFFLRLFLDRFVFQRIAVWLLSTASSAPIKMKDASTRAKLVKCKESLWK
LLFYGACDIFVLKVLFHEPWATDVKLYFHGWPNQELKLPIKLYYMCQCGFYMYAVAALIAWETRRKDFSVMMSHHVVTII
LLAYSYLTSFFRIGAIIIALHDASDVFMETAKICKYSEKEFGASVGFSLFALSWLLLRLIYFPFWIIRATSIELLDHVDM
TSAEGTIMYYSFNTLLLTLLVFHIYWWYLICAMIARLLKNRGQVGEDIRSDSEDDE*

DNA
ATGGAATCGTTATATTCTAGCGGCGGAGTAAGGAATCTTGAAGCGTCGATTGCGGCGTGGAATTTCCAGATAGCAGTCTA
TTTCGCCTTCGGATTCTTCTTCTTGAGACTCTTCCTCGATAGATTCGTCTTTCAAAGGATAGCTGTATGGCTTTTGAGCA
CCGCTTCTTCTGCGCCTATTAAAATGAAGGATGCTTCTACAAGGGCTAAGCTCGTCAAGTGCAAAGAGTCTCTGTGGAAG
CTCTTGTTTTACGGTGCTTGTGACATATTCGTTCTCAAAGTCCTTTTTCACGAGCCATGGGCCACAGATGTCAAACTCTA
CTTTCACGGTTGGCCTAATCAAGAGTTGAAGCTTCCGATAAAGCTTTACTATATGTGCCAGTGCGGTTTCTATATGTATG
CTGTTGCTGCCTTGATTGCATGGGAGACAAGACGAAAAGATTTTTCTGTTATGATGTCTCACCATGTCGTTACCATCATC
CTCCTTGCCTACTCCTACTTAACCAGCTTTTTCAGAATTGGAGCAATAATCATAGCCCTTCATGATGCAAGCGACGTGTT
TATGGAAACTGCTAAAATTTGCAAGTACTCTGAAAAGGAATTTGGAGCGAGTGTGGGTTTTTCACTCTTTGCTCTCTCTT
GGCTACTGCTTAGGTTGATTTACTTTCCATTTTGGATCATCAGGGCCACTAGCATTGAACTCCTGGATCATGTTGATATG
ACATCTGCTGAAGGCACAATCATGTACTATTCCTTCAACACACTGTTACTGACGCTTCTTGTTTTCCACATATATTGGTG
GTATCTCATCTGCGCAATGATTGCAAGACTACTTAAAAACAGAGGACAAGTGGGAGAAGACATAAGATCCGATTCAGAGG
ATGATGAATAG