Details for Kale Locus Bo5g115310

Position : C5 ( 5`- 35309716 .. 35312058 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115310

Protein [Map View]
MGVFSNLRGPKIGSTHEGLAVANASPPSSLRRKVSSFLPICVAIVVLVEIASMGRLDNASLLDTFTGFLAKSPSDKLSPT
KPSGLKVGSGMERCEEWLEREDSDFESCSVDCAIGMKSNTTPDAAFGLSHQPGTLSILRSMESARYYLQNNLAQARRKGY
DIVMTTSLSSDVPVGYFSWAEYDVMAPVQPKTEKALAAAFISNCIAQNFRLQALEALMEANVTIDSYGTCHRNRNERVEK
VEALKHYKFSLAFENTNEEDYVTEKFFQSLVAARVPDQLQPKAFLILAQTFATREQLQHTTSSSFATASDSSRPTIKDVR
DPIEATRSIPARVPFVSSSRLNSFGGPIQQSSKVKR*

DNA
ATGGGGGTTTTCTCCAATCTCCGAGGACCCAAAATTGGATCGACCCACGAGGGATTAGCCGTAGCCAATGCCTCTCCTCC
TTCCTCCCTCAGGCGTAAAGTTTCCAGCTTTTTGCCGATCTGCGTGGCTATCGTCGTCCTCGTCGAGATCGCGTCTATGG
GTCGCCTCGATAACGCCTCTTTGCTCGATACATTTACGGGTTTTCTCGCCAAGTCGCCTTCGGACAAGCTGTCTCCGACT
AAACCGTCCGGTTTGAAGGTTGGGTCGGGAATGGAGAGGTGCGAGGAGTGGTTGGAGAGAGAGGATTCAGACTTCGAATC
GTGCTCAGTTGATTGCGCAATTGGAATGAAATCAAATACAACCCCCGATGCAGCGTTTGGATTAAGTCATCAGCCTGGAA
CACTCAGTATACTACGTTCCATGGAATCAGCAAGATACTACCTTCAGAACAATCTTGCTCAGGCACGACGGAAGGGTTAT
GATATTGTGATGACAACTAGTCTATCATCAGATGTTCCCGTTGGGTACTTCTCATGGGCGGAGTATGATGTTATGGCTCC
AGTACAGCCAAAGACCGAGAAAGCTCTTGCTGCTGCTTTCATTTCCAATTGCATTGCTCAGAATTTTAGGCTGCAAGCTC
TTGAAGCCTTGATGGAGGCAAATGTTACGATTGATTCTTATGGTACTTGTCACCGGAACCGTAACGAGAGAGTGGAGAAG
GTTGAAGCTCTTAAGCACTATAAGTTCAGTCTAGCTTTTGAGAACACCAATGAGGAGGATTATGTCACCGAGAAGTTCTT
CCAATCTCTTGTCGCTGCTCGCGTCCCCGATCAGCTTCAGCCCAAGGCGTTCCTGATCCTAGCTCAGACGTTCGCGACCC
GAGAGCAGCTCCAGCACACGACCTCTTCCTCGTTCGCGACAGCATCAGACAGCTCGCGTCCGACGATCAAAGACGTCCGC
GACCCGATAGAAGCGACTCGATCCATTCCAGCTCGAGTCCCGTTCGTGTCTAGCTCGCGGCTCAACTCATTTGGTGGTCC
GATTCAACAATCATCTAAGGTTAAAAGGTAA