Details for Kale Locus Bo5g115300

Position : C5 ( 5`- 35305387 .. 35306996 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115300

Protein [Map View]
MGTQINFGGDPGGEGFNQMKPTDTAYPLARQSSLYSRTFDELQSLLGGPGKDYGSMNMDELLKSIWTAEEAQAMSMTMTS
SAPTTMVQPGGNLQRQGSLTLPRTISQKTVDEVWKCLITKDGGGCSGGGGGESNNAPQRQQTLGEMTLEEFLSRAGVVRE
DNNSSQHMGQVTGNNNNGFYGNNGAPGGLGFEFVQPNQNSISFNNGTMQQQQQFQQQPQQQSRQQLNQSHPQQQQQRLPQ
TIFPKQANVAFAVNKSFNGAVNNSMNNTNGLASFGGAGVTVAATSPGTSSAENNSLSPVPYVLNRGRRSNTGLEKVIERR
QRRMIKNRESAARSRARKQAYTLELEAEIEKLKKVNQELQRKQAEMMEMQKNELKESSKKPWGSKRQCLRRTLTGPW*

DNA
ATGGGAACTCAAATCAATTTCGGTGGTGACCCTGGTGGGGAAGGATTCAACCAGATGAAGCCAACAGATACTGCATATCC
CTTGGCGAGACAGTCTTCGCTTTACTCACGAACGTTTGATGAGCTTCAGAGCTTACTAGGTGGACCTGGAAAAGATTACG
GGTCGATGAACATGGATGAACTCTTGAAGAGCATATGGACTGCTGAGGAAGCTCAGGCCATGTCCATGACCATGACTTCT
TCAGCTCCTACAACGATGGTGCAACCTGGTGGGAATCTCCAGAGGCAAGGCTCGTTGACATTGCCTAGAACGATTAGTCA
GAAGACTGTCGATGAGGTCTGGAAATGTCTGATCACCAAAGACGGTGGAGGTTGCAGCGGAGGAGGCGGTGGTGAGTCTA
ATAATGCGCCGCAGAGGCAACAGACATTAGGGGAAATGACACTTGAGGAGTTTCTGTCCCGCGCTGGAGTTGTAAGAGAA
GATAACAACTCTTCACAGCATATGGGTCAGGTCACTGGAAACAATAACAACGGCTTTTATGGTAACAACGGAGCTCCTGG
GGGATTAGGCTTTGAGTTTGTTCAACCAAATCAAAACAGCATATCATTCAACAATGGTACAATGCAGCAGCAGCAGCAGT
TTCAACAACAGCCACAACAGCAGTCACGACAGCAGCTGAATCAGTCACATCCTCAGCAGCAGCAGCAGAGGCTGCCTCAG
ACCATTTTTCCTAAACAAGCAAATGTTGCATTTGCTGTCAACAAGAGTTTTAATGGGGCTGTGAATAATTCAATGAACAA
TACTAATGGTTTAGCTAGTTTCGGAGGAGCCGGGGTTACTGTTGCAGCAACGTCTCCAGGGACAAGCAGCGCAGAAAACA
ACTCTCTGTCACCAGTTCCTTATGTGCTTAATCGAGGAAGAAGAAGCAATACTGGCCTAGAGAAGGTTATCGAGAGGAGG
CAGAGGAGAATGATCAAGAACCGAGAATCAGCTGCTAGATCAAGAGCTCGAAAGCAGGCTTATACCTTGGAACTGGAAGC
TGAAATTGAAAAGCTGAAGAAAGTGAATCAAGAATTGCAGAGAAAACAGGCTGAAATGATGGAAATGCAGAAGAATGAGC
TGAAGGAATCATCGAAGAAACCGTGGGGCAGCAAAAGGCAATGCTTGAGAAGGACACTAACCGGTCCATGGTAA