Details for Kale Locus Bo5g115290

Position : C5 ( 5`- 35302349 .. 35304976 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115290

Protein [Map View]
MVLHKQALLLTFISVLGIHQLPLPAEAECPLDLTSSNFTLVASVCSTNADRAKCCRYMNAFVAVSVSRYANHTADLGVAP
DLTSICITTISRTMELYGIPTNATLFCGLGTKILVSYDCEDLTTVTQMLRSPKFGDVSRNCELPFRCKSCLNSGITYIRS
LVDRGNNIKMSTCRDATYAALASRVDTTSALELASCFFNVSELTTTPEFPLSPEASPSPELADSPSGNDDIVLSPRRSHH
GYHLTVVPAIGIAVTVFSVMMLAVLIVLIQRKKRELDDDDSEGKDHNPTKTLPSSLPKVMMIHEGSSLAFRKFSYREIRK
ATKEFSSVIGSGGFGTVHRGEFSNGLVAAVKRMNRSSEQAEDEFCREIELLARLHHRHLVALKGFCTKKNERFLVYEYMA
NGSLTDHLHSTEKPPLSWATRMKIAIDVANALEYLHLYCDPPLCHRDIKSSNILLDDNFAAKLADFGLAHASRDASVCSE
PINTDIRGTPGYVDPEYVVTQELTEKSDVYSYGVVLLEIITGRTAVDQGRNLVEMSQPLLVSESRRVDLVDPRIKDCIDG
EQLETVVAVVRWCTEKEGVARPSIKQVLRLLCESCDPLHMELAMAVEEHKGRSLRGGGDSGLASSSSTTSRSHCSRSFLL
ETGGSPPNGLSF*

DNA
ATGGTGCTTCACAAGCAAGCTCTCTTGCTCACATTCATCTCAGTTCTTGGAATCCATCAACTGCCTTTACCAGCAGAAGC
AGAATGTCCACTGGACTTAACCTCATCCAACTTCACTCTCGTCGCCTCCGTCTGCTCCACCAACGCCGACAGAGCCAAAT
GCTGCCGCTACATGAACGCCTTCGTCGCCGTATCCGTCTCCCGCTACGCTAACCACACGGCAGATCTCGGAGTGGCACCA
GACTTGACCTCCATCTGCATCACCACCATCTCAAGAACCATGGAGCTCTACGGAATCCCAACTAACGCGACCCTCTTCTG
CGGACTAGGCACCAAGATCCTCGTCAGCTACGACTGCGAGGATCTCACCACCGTGACGCAGATGCTCCGGTCCCCAAAGT
TTGGAGATGTTTCAAGAAACTGCGAACTACCGTTTCGTTGCAAGAGCTGCTTGAACTCTGGTATCACTTACATTCGTAGT
TTGGTGGATAGAGGGAATAACATTAAGATGAGTACTTGTAGGGATGCGACCTACGCTGCTTTAGCTAGCCGTGTTGATAC
TACTTCAGCTCTTGAGCTTGCTAGCTGCTTCTTTAATGTGTCTGAGCTTACCACCACTCCAGAGTTTCCGTTGAGTCCAG
AAGCTTCTCCAAGTCCAGAGTTAGCTGATAGTCCAAGTGGCAATGATGATATTGTCTTGTCTCCAAGAAGAAGTCACCAT
GGTTATCACTTGACGGTGGTTCCGGCTATTGGGATCGCTGTTACAGTGTTCTCTGTTATGATGCTCGCTGTTCTGATAGT
TCTTATCCAGAGAAAGAAACGGGAGCTTGATGATGATGACTCCGAGGGCAAGGATCATAATCCAACGAAGACGCTTCCTT
CTTCCCTCCCTAAAGTGATGATGATTCATGAAGGTAGTTCGTTGGCTTTTAGGAAGTTTAGCTACAGGGAGATAAGGAAA
GCAACTAAAGAGTTCAGCAGTGTGATTGGCAGTGGGGGCTTTGGGACTGTTCATAGAGGTGAGTTCAGTAATGGGTTGGT
TGCAGCTGTGAAAAGGATGAACAGGAGCTCTGAACAAGCGGAAGATGAGTTTTGCAGAGAGATTGAGCTTCTGGCCAGGC
TGCACCACCGCCATCTAGTTGCTTTGAAAGGCTTTTGTACTAAGAAGAACGAGAGATTCCTTGTCTACGAGTATATGGCA
AATGGGAGCTTGACGGATCATCTACATTCTACAGAGAAACCTCCACTTAGTTGGGCAACAAGGATGAAAATAGCAATCGA
TGTGGCTAATGCTCTGGAGTACCTTCATCTCTACTGTGATCCACCTCTCTGTCACAGAGACATTAAGTCAAGCAACATAT
TACTCGACGACAACTTTGCTGCTAAGCTTGCAGATTTTGGGCTTGCACATGCTTCCAGAGATGCCTCCGTTTGTTCTGAA
CCTATTAATACTGATATCCGTGGAACTCCAGGCTATGTAGATCCAGAGTATGTTGTAACACAAGAACTGACAGAGAAGAG
CGACGTGTACAGCTACGGAGTGGTGTTGCTAGAGATCATAACAGGCAGAACCGCTGTCGACCAAGGTAGGAACCTGGTGG
AAATGTCTCAGCCTTTACTTGTGTCAGAATCAAGACGGGTGGATCTGGTGGATCCGAGAATCAAAGACTGCATAGACGGT
GAACAGCTGGAGACAGTAGTGGCGGTTGTGAGATGGTGCACTGAGAAAGAAGGCGTAGCAAGGCCATCGATCAAGCAAGT
CTTGAGGCTGTTGTGTGAGAGCTGTGATCCGTTGCATATGGAGCTTGCAATGGCGGTTGAAGAGCACAAAGGGAGGTCAC
TGAGAGGTGGTGGTGACTCAGGGTTGGCTTCTTCCTCTAGTACTACTTCAAGGTCGCATTGTAGCAGGAGTTTCCTGCTT
GAGACTGGTGGCTCTCCACCGAATGGTCTCTCCTTTTGA