Details for Kale Locus Bo5g115270

Position : C5 ( 5`- 35291098 .. 35294312 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115270

Protein [Map View]
MFQSLTFFLTVLFIPCFLIFNPSSALKEGETCIVTKNCDQGLHCESCLSSDNFRPRCSRMQTVNPTSKVKGLPYNKYTWL
TTHNSFARIGARSGTGSMILAPSNQQDSITSQLINGVRGFMLDMYDFQNDIWLCHSYGGNCFNYTAFQPALNILHEFQVF
LDKNKDVVVTLILEDYVKSPNGLGRVFDASGLRNFMFPVTSMPKNGEDWPTIDEMITKNQRMLVFTSNPQKEATEGFAFL
WKYMVENQYGNGGMRPGVCTNRPESAAMGDTSRSLVLVNYFPDTADLIGSCKQNSAPLLEAIQKCQEASGQRWPNFIAVD
FYKRSDGGGAPKAVDVANGRSLCGCDDISACKENMPYGTCEKREEEPTKLDSKLMMIAKLTADATKPTQLGLSVFVVTFV
SLLSFFGH*

DNA
ATGTTTCAAAGTCTCACCTTCTTTCTAACAGTTCTTTTCATTCCATGTTTTCTCATCTTTAACCCTTCCTCTGCCCTCAA
GGAAGGAGAAACATGCATCGTGACCAAGAATTGTGATCAGGGACTACACTGCGAATCGTGTCTCTCAAGCGATAATTTTC
GACCTAGATGCTCCCGAATGCAAACCGTTAACCCCACCTCTAAGGTGAAAGGGTTGCCTTACAACAAATACACGTGGTTG
ACAACACACAATTCATTTGCTCGAATAGGTGCAAGATCAGGCACAGGCTCTATGATTCTTGCTCCTTCCAACCAACAAGA
TTCAATCACAAGCCAACTTATTAATGGTGTTAGAGGGTTTATGCTTGACATGTACGACTTCCAAAACGATATATGGCTTT
GCCATTCTTATGGTGGAAACTGCTTCAACTATACAGCGTTTCAACCGGCGCTTAACATTCTACACGAGTTTCAAGTGTTT
CTAGACAAGAACAAGGATGTGGTTGTGACACTTATCCTCGAGGACTACGTGAAATCTCCCAATGGTTTAGGCAGAGTGTT
TGATGCATCCGGGTTACGAAACTTCATGTTTCCGGTAACAAGTATGCCTAAGAACGGAGAAGATTGGCCTACCATCGATG
AAATGATAACTAAGAACCAACGGATGCTGGTTTTTACGTCAAATCCTCAAAAAGAAGCTACCGAAGGATTCGCATTTTTA
TGGAAATACATGGTAGAGAATCAATATGGAAATGGAGGCATGAGGCCTGGAGTGTGTACCAATAGACCAGAGTCAGCTGC
TATGGGAGATACATCGAGATCACTAGTTCTGGTAAACTATTTTCCGGATACTGCGGATTTGATCGGATCTTGTAAACAGA
ACTCTGCTCCTCTTCTTGAGGCCATACAAAAATGTCAAGAAGCCTCTGGACAACGCTGGCCTAACTTTATTGCCGTTGAT
TTCTACAAGAGGAGCGATGGTGGAGGAGCTCCAAAAGCAGTTGATGTTGCTAACGGCCGCTCACTTTGCGGCTGTGACGA
TATATCCGCTTGTAAGGAGAATATGCCGTATGGGACGTGTGAGAAACGTGAAGAAGAGCCGACGAAACTGGATTCAAAAC
TCATGATGATTGCGAAACTTACAGCCGATGCTACCAAACCGACCCAACTTGGGCTTTCTGTGTTTGTTGTAACCTTTGTC
TCACTTCTCTCATTTTTTGGACATTGA