Details for Kale Locus Bo5g115230

Position : C5 ( 5`- 35273398 .. 35274663 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115230

Protein [Map View]
MPRSLEPLDLGIQIPYHFRCPISLELMRDPVTVCTGQTYDRTSIESWVSTGTNTTCPVTRAPLSDFTLIPNHTLRRLIQE
WCVANRSNGVERIPTPKQPADPTSVRSLLSQASAACGTHVSIRSRAAALRRLRAFARDSEKNRVLIAAHNAKEILIRILF
SDVAPELVSESLALLAMFPMTEPDQCESIISDAGRVGFLTRLLFDSSIETRVNAAALIEMVVTGSKTADIKGTVLTSECI
FEGVIDLLRNPTVTSSPRRALKIGVKALFALCLAKNTRRIAVSSGAPEILIDRLAAGLDRCDTERALATVELLCRTAEGC
AAFGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWRDEAVAAGVVVQLLLMVQSECTERAKRKAQKLLKLLRD
SSLDYSFANSDDFACSEVVPF*

DNA
ATGCCGAGAAGTCTAGAGCCGTTGGATCTAGGAATCCAGATACCGTACCATTTCAGATGTCCAATCTCACTAGAGCTGAT
GCGTGACCCGGTAACCGTCTGCACCGGTCAAACCTACGACCGAACAAGCATCGAGTCATGGGTCTCCACAGGAACCAACA
CGACATGTCCTGTCACACGCGCTCCTCTGTCCGACTTCACTCTCATCCCAAACCACACTCTCCGCCGTCTCATCCAAGAA
TGGTGCGTCGCCAACCGCTCCAACGGCGTCGAGCGCATCCCTACTCCCAAACAGCCCGCTGATCCAACCTCCGTCCGATC
TCTCCTCAGCCAAGCCTCCGCCGCGTGTGGAACTCACGTCTCCATTCGCTCCCGCGCCGCCGCCCTCCGCCGTTTGCGTG
CGTTCGCGCGCGATTCCGAAAAGAACCGCGTTTTGATCGCGGCGCACAACGCCAAAGAGATTCTGATCAGGATTCTGTTC
TCCGACGTGGCTCCAGAGCTGGTCTCCGAGTCCCTCGCTCTTCTAGCTATGTTCCCGATGACGGAGCCTGATCAGTGCGA
ATCTATAATCTCGGATGCGGGTCGGGTCGGGTTCCTGACCCGGTTACTATTCGATTCCTCTATCGAAACGCGCGTTAACG
CGGCCGCGTTGATAGAGATGGTTGTGACGGGATCGAAGACGGCTGATATCAAAGGAACGGTTTTAACCTCTGAGTGTATA
TTCGAAGGAGTTATCGATCTTCTACGTAATCCTACGGTAACGTCGTCCCCACGGCGAGCTCTCAAGATCGGAGTCAAAGC
CCTGTTCGCGCTCTGCCTCGCCAAAAACACGCGCCGCATCGCCGTATCCTCCGGTGCACCGGAGATTCTAATCGACAGAC
TCGCGGCGGGATTAGACAGGTGCGACACCGAGCGAGCTCTGGCTACGGTGGAGCTTCTCTGCCGGACGGCGGAGGGATGC
GCGGCGTTCGGCGAGCACGCTCTGACGGTGCCGCTTCTTGTGAAGACGATTCTGAGGGTTTCGGATCGTGCGACGGAGTA
CGCGGCGGGAGCGTTGTTGGCGCTTTGCACGGCGGAGGAAAGGTGGAGAGACGAGGCGGTGGCGGCGGGAGTGGTGGTGC
AGTTGCTGCTGATGGTGCAGAGTGAGTGTACGGAGAGGGCGAAGAGGAAGGCACAGAAGCTGCTGAAGCTTCTGAGAGAC
TCGTCGCTTGACTACTCCTTCGCTAACTCCGATGATTTCGCCTGCAGCGAAGTGGTCCCCTTTTGA