Details for Kale Locus Bo5g115150

Position : C5 ( 5`- 35191079 .. 35194223 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115150

Protein [Map View]
MSSESPNLPATVTPDAHPPPAAVEAGSDDSPKGVASKLSASGISTWAKSLKVPQPFASTSDDGDNTEKSAFAKFTSGLGL
RLSPKSPQPDETTDGASSSAQPGLFGAITKGLVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYITENIIAMGFP
AGDMSSGFFGYVEGFYRNQMEEVINFLETQHKGKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIHLITSFCQSAYS
WLKEDIENVVVVHCKAGMARTGLMICSLLLYLKFFPTAEECMDFYNQKRCVDGKGLVLPSQIRYVKYFERILTYFNGENQ
PGRKCMLRGFRLHRCPYWIRPSVTISDHNGVLFTTKKHLRTKDLSPEDFWFSAPKKGVMVFALPGEPGLTELAGDFKIHF
HDRQGDFYCWLNTTMMENRVILKTSELDGFDKRKLPSPGFMVEVVLADIDSTIPPKPSSEPASKAPEETSAANSSPAEVV
TPVPAPKKETENPDKDDVFSDNEADSTGPTKTTSSVSSQTPEAKQSADETAGLTRATEKVSISGNKGSSSSSQPVQGTVS
KAEAAEKPTGSGVNVSSSESSEFKVMAADASVFSFGDEDEFESD*

DNA
ATGTCATCTGAATCACCGAATCTCCCTGCTACGGTCACACCAGATGCTCACCCTCCTCCTGCTGCTGTAGAAGCTGGAAG
CGATGATTCACCTAAAGGCGTAGCGTCAAAGCTATCTGCCTCTGGGATCTCAACGTGGGCCAAAAGCTTGAAAGTTCCCC
AGCCCTTTGCTTCCACCTCTGATGATGGGGATAATACTGAAAAGTCCGCCTTTGCCAAGTTTACAAGCGGGTTAGGGCTT
CGTTTGTCTCCCAAATCTCCTCAGCCAGATGAGACCACGGACGGAGCTTCTTCTTCTGCACAACCCGGTTTGTTTGGGGC
GATTACGAAGGGTTTGGTTGATACGTCAAAGAACGCTGTCAAGGCAGTTCAGGTCAAGGCTCGTCATGCTGTGTCTCAGA
ACAAAAGAAGATACCAGGAAGGAGGGTTTGATTTGGATCTGACTTACATAACAGAGAACATTATTGCTATGGGGTTTCCT
GCTGGTGATATGAGTTCTGGCTTTTTTGGATATGTCGAGGGTTTCTACCGCAACCAGATGGAAGAAGTTATTAACTTTCT
TGAAACTCAACACAAGGGAAAATACAAGGTTTACAATCTTTGTTCAGAGAGGTTGTATGATGTATCACTATTTGAAGGGA
AGGTGGCCAGTTTCCCATTTGATGATCACAATTGTCCACCAATCCATTTGATTACCTCCTTTTGCCAAAGTGCATATTCG
TGGTTGAAGGAGGACATAGAGAATGTTGTGGTTGTTCACTGTAAGGCGGGAATGGCCAGGACAGGGCTTATGATATGTAG
TCTTCTTCTCTATCTGAAGTTTTTTCCAACTGCGGAAGAGTGCATGGACTTCTACAATCAGAAACGATGTGTGGATGGAA
AAGGACTTGTGCTACCTAGCCAAATTAGATATGTGAAATACTTTGAACGAATATTAACATACTTCAACGGGGAAAACCAA
CCAGGCCGCAAGTGTATGCTTAGGGGATTCCGGCTCCACAGGTGTCCCTATTGGATCAGGCCATCCGTCACCATTTCAGA
TCACAATGGTGTTCTCTTTACCACGAAAAAGCATCTTCGAACCAAGGATTTATCGCCAGAAGACTTTTGGTTCAGTGCGC
CAAAGAAAGGGGTTATGGTCTTTGCCTTACCCGGAGAGCCTGGTCTAACAGAATTGGCTGGGGACTTCAAAATCCATTTC
CACGACCGCCAAGGAGATTTTTACTGCTGGTTAAACACGACAATGATGGAAAACAGAGTGATCCTAAAAACCAGTGAGCT
TGACGGGTTTGACAAGAGGAAGCTACCTTCGCCTGGGTTTATGGTCGAAGTTGTTCTTGCTGATATTGACTCAACAATCC
CTCCAAAACCAAGTTCTGAACCAGCATCCAAGGCACCTGAAGAAACTTCAGCAGCTAATTCTTCCCCTGCAGAGGTTGTT
ACACCTGTTCCAGCACCTAAGAAAGAAACAGAGAACCCTGATAAGGACGATGTCTTCTCTGACAACGAAGCAGACTCAAC
TGGTCCAACCAAAACCACATCATCTGTTTCTTCTCAAACCCCAGAAGCCAAGCAGAGCGCAGATGAAACCGCTGGTCTGA
CTCGTGCGACTGAGAAAGTGTCTATTTCTGGAAACAAGGGATCATCATCATCATCACAGCCGGTGCAAGGAACGGTTAGC
AAGGCTGAAGCGGCAGAGAAACCCACTGGGTCAGGGGTAAACGTGTCAAGCTCAGAGAGTAGTGAGTTCAAGGTTATGGC
GGCCGATGCATCTGTGTTCTCGTTTGGAGATGAAGACGAGTTTGAAAGCGATTGA