Details for Kale Locus Bo5g115110

Position : C5 ( 5`- 35163577 .. 35165397 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g115110

Protein [Map View]
MALAKHTRVQILGCILLASLALTMADTPPGIAKNPSHATCKIKKYKHCYNLEHVCPKFCPDSCHVECASCKPICGPPSPG
SDDDGGDGGDDDGGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPAVPSPTPPVSPPPPTPTPAVPSPTPPVSPPP
PSPTPAVPSPTPPSSPPPPTTPPTPSVPSPPGTPTAPVPPYSPPATPTPSIPSPTPTPPGSTPPYVPPSSPTPSPPSDGE
AGAGVRRARCKKKGSPCYGVEYSCPADCPRSCEVDCVTCKPLCNCDKPGSVCQDPRFIGGDGLTFYFHGKKDSNFCLISD
SNLHINAHFIGKRRSGMARDFTWVQSIAILFGTHRFYVGALKTSTWDDSVDRISASFDGHVISLAQLDGATWTSSPGVYP
QVSVKRVNADTNNLEVEVEGMLKITARVVPITVEDSRIHGYNVTEDDCLAHLDLGFKFQDLSDNVDGVLGQTYRSNYVSR
VKIGVHMPVMGGDREFQTSGLFEPDCSAARFPGNRGSNGGRSKMELPEMSCASGVGGKGVVCKR*

DNA
ATGGCTCTAGCCAAACACACAAGAGTTCAGATATTGGGATGCATACTCCTTGCATCACTCGCACTAACAATGGCTGATAC
ACCACCGGGCATAGCCAAAAACCCAAGCCATGCAACATGTAAGATCAAGAAGTACAAACATTGCTACAATTTGGAACATG
TTTGTCCCAAGTTCTGCCCTGACTCTTGTCATGTTGAATGTGCTTCTTGCAAACCCATATGTGGCCCTCCTTCCCCCGGC
AGTGATGATGATGGTGGCGATGGTGGCGATGATGACGGTGGATACACTCCTCCGGCTCCAGTTCCACCTGTTTCACCACC
ACCTCCTACACCTTCTGTGCCAAGCCCTACTCCCCCAGTTTCACCACCACCTCCAACACCTACACCAGCCGTTCCAAGTC
CCACTCCGCCGGTTTCACCACCACCTCCAACTCCTACACCGGCTGTGCCAAGTCCCACGCCACCGGTTTCACCACCACCA
CCTTCTCCTACACCAGCTGTGCCAAGTCCAACTCCACCATCTTCACCACCACCTCCTACAACACCTCCTACACCGTCTGT
GCCAAGTCCTCCAGGTACTCCCACTGCACCAGTCCCTCCATATTCCCCACCTGCGACTCCTACTCCCTCCATTCCAAGTC
CTACTCCTACACCTCCCGGCTCTACTCCTCCTTATGTCCCTCCGTCCTCTCCTACTCCATCCCCGCCATCAGATGGAGAG
GCAGGAGCAGGAGTAAGAAGAGCCAGGTGTAAGAAGAAGGGCTCTCCTTGTTACGGAGTTGAGTATAGTTGCCCGGCCGA
TTGCCCCCGTTCTTGTGAAGTTGACTGCGTTACTTGCAAACCTCTTTGCAATTGCGACAAACCGGGATCGGTTTGCCAAG
ACCCACGTTTTATTGGAGGAGATGGTCTAACCTTTTACTTCCACGGCAAGAAAGACTCCAACTTCTGCCTCATCTCCGAT
TCTAACCTTCACATCAACGCACATTTCATCGGTAAACGAAGGTCTGGTATGGCACGTGACTTCACATGGGTCCAATCCAT
TGCTATCCTCTTCGGCACTCACCGTTTCTACGTCGGAGCCCTTAAGACCTCCACGTGGGACGATTCTGTTGACCGGATCT
CCGCCTCTTTTGATGGACATGTTATCTCACTCGCTCAACTAGATGGTGCCACGTGGACTTCTTCCCCTGGAGTATACCCT
CAGGTCTCGGTCAAACGAGTCAACGCTGACACTAACAACCTCGAGGTTGAAGTAGAGGGCATGCTTAAGATCACAGCAAG
AGTGGTGCCAATAACAGTGGAAGATTCAAGAATTCATGGTTACAATGTAACGGAAGACGACTGTCTCGCTCATCTCGACT
TAGGCTTTAAGTTCCAAGACCTTAGCGACAACGTCGATGGTGTTTTGGGACAAACGTATAGGTCTAACTACGTAAGCCGA
GTCAAGATCGGAGTCCACATGCCTGTGATGGGTGGTGATAGGGAATTCCAGACCAGCGGACTTTTTGAACCTGACTGCTC
AGCCGCAAGGTTCCCTGGTAACAGAGGTAGCAACGGTGGCCGGAGTAAAATGGAGCTCCCTGAGATGAGTTGTGCAAGTG
GCGTAGGTGGCAAGGGAGTGGTCTGCAAGAGATAG