Details for Kale Locus Bo5g114110

Position : C5 ( 5`- 35134719 .. 35136948 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g114110

Protein [Map View]
MAANWRVATAALRRHLLSPPPIIFAAFRESTGALSAANQRRSYTTALADDDPRGKWLTLPPFSPTIDAAAVGKELSFDDG
DSVVKGSNDGSTTALRWILRCRPDLPRNLVQKLFRLRQVRRQVVVVVPMSCELQRSQLKRVAAKESLNVGDRIYLPLSVG
NDAPQPAKKERFLCSEEERKFVCSLVLYKDPAIIVLNKPHGMAVQGGTGVKTSIDELAATCLTFDKSESPRLVHRLDRDC
SGLLVLGRTQTAATLLHSIFREKTSGASAYGVKKNIKSLKRKYLALVIGCPRRQRGQISAPLRKLVVDDGKSDRITVNDN
GELVSTQHAITEYRVVESSPHGYTWLELRPLTGRKHQLRVHCAEVLGTPILGDYKYGWQAHKTREPFVSPENTRTKTSSP
FGLDMEGGDVSSKQPHLHLHSKQIDLPNICQLLEKLEVSSDSDISDLDSLKFDAPLPTHMQLSFNLLKSRVETCDYC*

DNA
ATGGCGGCCAATTGGAGAGTTGCGACCGCGGCCCTCCGTCGTCATCTCCTATCCCCACCGCCTATTATCTTTGCCGCCTT
CAGGGAGTCCACCGGAGCCTTATCCGCGGCTAATCAGCGTCGTAGCTACACGACAGCTCTCGCTGATGATGATCCGAGAG
GGAAATGGCTCACGCTACCTCCTTTCTCTCCCACCATCGACGCCGCCGCGGTAGGAAAGGAGCTCTCTTTCGACGACGGA
GACTCTGTCGTCAAAGGCTCAAATGATGGCTCAACGACGGCGCTGAGGTGGATTCTTCGTTGCCGTCCTGACCTACCTAG
AAACCTCGTACAGAAACTCTTTCGTTTAAGACAGGTTAGAAGACAAGTAGTAGTAGTAGTGCCTATGAGTTGTGAACTAC
AAAGAAGCCAACTTAAAAGGGTGGCAGCCAAGGAGTCATTGAATGTGGGAGATAGAATTTACCTTCCTCTATCTGTTGGC
AATGATGCTCCCCAGCCTGCTAAGAAAGAACGCTTTCTTTGCAGTGAAGAAGAGCGCAAATTCGTTTGCAGTTTAGTGTT
GTACAAGGATCCAGCCATTATTGTCTTGAATAAACCTCATGGTATGGCTGTTCAAGGAGGGACTGGGGTGAAAACCAGCA
TTGATGAACTCGCTGCCACTTGTTTGACTTTTGATAAGTCAGAATCTCCCCGGCTGGTGCACAGACTTGACAGAGACTGT
AGTGGGCTTTTGGTGTTGGGAAGAACACAAACAGCTGCAACACTTCTTCATTCTATATTCCGCGAGAAAACATCTGGTGC
TTCCGCCTATGGTGTCAAGAAGAACATAAAATCCTTGAAAAGAAAATATCTGGCACTCGTGATCGGGTGCCCAAGACGTC
AAAGGGGACAGATCTCAGCGCCACTCAGAAAGCTTGTTGTGGATGATGGAAAATCTGATCGCATCACAGTTAATGACAAT
GGAGAACTAGTTTCCACTCAGCACGCTATCACTGAATACCGAGTGGTCGAATCTTCACCACATGGATACACATGGCTGGA
GCTTCGTCCTTTAACCGGCAGAAAACATCAGCTCCGTGTACACTGCGCAGAAGTGCTAGGAACACCGATACTCGGGGACT
ATAAATACGGTTGGCAAGCTCATAAAACCAGGGAACCTTTTGTGTCTCCAGAAAACACCCGGACCAAGACATCATCTCCT
TTTGGCCTCGATATGGAAGGTGGAGATGTATCTTCAAAACAGCCACACCTTCATCTCCATTCTAAGCAAATCGATCTGCC
AAACATCTGTCAGCTCTTGGAGAAATTGGAGGTTTCTTCCGACTCTGATATCTCGGATCTCGATAGCCTTAAATTCGATG
CTCCGTTGCCTACTCATATGCAGCTAAGCTTCAACTTGTTGAAATCTAGAGTCGAAACTTGTGACTATTGTTAG