Details for Kale Locus Bo5g114090

Position : C5 ( 5`- 35128533 .. 35129770 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g114090

Protein [Map View]
MGDSASSSSSSSTRVSVHNSLGGGSVADLLLWRNRTGAVIVLVSSTVFWFLFERAGYNLLSFVSNVVLLLVAILFLWAKS
ASLLNRPLPPVPNMEIPEELAVKAADDIRVWINRVLSIASDITIARNPIRLLQVSLVLWAISYVGTFINSLTLVYVGILL
SLSVPLVYEKYQDHIDDKLNSTSKVIRSISMKIPMMPVSKEKKYQ*

DNA
ATGGGAGATTCCGCTTCTTCTTCTTCTTCTTCTTCAACACGCGTTTCTGTTCACAATTCTCTCGGCGGTGGTTCAGTTGC
CGATTTGCTGCTGTGGAGAAACCGGACTGGTGCAGTCATTGTCCTAGTCTCCTCTACTGTGTTCTGGTTTCTGTTTGAGA
GAGCTGGTTACAATCTCTTGTCTTTCGTCTCCAACGTTGTGCTTCTTCTTGTTGCCATCCTCTTCCTATGGGCCAAGTCT
GCTTCCCTACTCAACCGACCTCTACCACCAGTTCCCAATATGGAGATCCCTGAGGAGCTTGCAGTTAAGGCTGCTGATGA
TATTCGTGTTTGGATCAATCGTGTGTTGTCAATTGCAAGTGATATCACCATTGCTAGAAATCCCATCCGTCTCCTTCAGG
TGTCACTGGTCTTGTGGGCTATATCCTATGTGGGGACGTTTATCAACTCCCTCACTCTTGTCTACGTTGGGATTCTTCTC
AGTCTTTCTGTTCCTCTTGTGTACGAGAAGTACCAAGACCACATCGACGATAAACTGAACTCGACTTCTAAAGTCATTCG
CAGTATCTCAATGAAGATTCCGATGATGCCCGTAAGCAAAGAAAAGAAGTACCAGTAG