Details for Kale Locus Bo5g114080

Position : C5 ( 5`- 35124905 .. 35127641 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g114080

Protein [Map View]
MAVLPIGSHFAPPHKLTKRHAVATSSPISLSTRLPQNVSVSKLSGITGSRLSRHSVLVRAEDKIRVSSPSSSLEEPSQPL
DESELEDLLDASGSCDPICSVDEPSSSYFEANYQPKTDIVKAIAILAAALTGTAAINHSWVAANQDLAMALLFGIGYAGI
IFEESLAFNKSGVGLLMAVSLWVVRGIGAPSTEIAVAELQHATAEVSEIVFFILGAMTIVEIVDAHQGFKLVTDNITTRK
PKTLLWVVGFVTFFLSSILDNLTSTIVMVSLLRKLVPQSEYRKLLGAVVVIAANAGGAWTPIGDVTTTMLWIHGQISTLP
TIQGLFIPSAISLAVPLALMSLSSEVNEKGQDSSDVLASEKMAPRGKLVFGVGLGALVFVPVFKALTGLPPYMGILLGLG
VLWVLTDAIHYGESERQKLKVPQALSRIDTQGALFFLGILLSVSSLEAAGILREIANYLDANIPNVELIASAIGVVSAII
DNVPLVAATMGMYDLTSFPQDSEFWQLVAFCAGTGGSMLIIGSAAGVAFMGMEKIDFFWYFRKVSGFAFAGYAAGIAAYL
AIQSVHFSIPTTVAQIPFLTGS*

DNA
ATGGCGGTGTTACCAATCGGCTCTCACTTCGCCCCGCCGCACAAACTGACAAAGCGACACGCCGTCGCGACTTCATCCCC
TATCTCTCTCTCAACCCGATTGCCTCAAAACGTCTCCGTTTCCAAACTCTCCGGAATCACAGGCTCGAGGCTGTCCAGAC
ACAGCGTTCTCGTGAGGGCCGAGGATAAGATCAGAGTCTCATCTCCTTCTTCTTCTCTCGAGGAACCATCTCAACCACTC
GATGAGTCAGAGCTTGAGGATTTGCTGGACGCATCAGGATCATGTGACCCTATTTGCTCAGTTGATGAGCCTAGCTCGAG
CTACTTCGAAGCGAATTATCAGCCAAAGACGGATATAGTCAAAGCTATTGCTATTCTCGCAGCTGCTCTCACAGGAACAG
CTGCCATTAATCATTCATGGGTCGCTGCTAACCAGGATCTTGCTATGGCGTTGTTGTTTGGAATAGGATACGCTGGAATC
ATCTTTGAAGAGTCTTTAGCTTTTAATAAAAGTGGAGTGGGGCTTCTGATGGCTGTCAGTCTGTGGGTTGTGAGGGGCAT
AGGGGCTCCTTCTACTGAAATAGCTGTTGCAGAGCTTCAACATGCAACAGCTGAAGTAAGTGAGATTGTGTTTTTCATAC
TGGGGGCAATGACCATTGTGGAGATTGTTGATGCTCACCAAGGGTTTAAGCTGGTTACTGACAATATAACCACTCGGAAG
CCAAAGACGCTTTTATGGGTGGTCGGCTTTGTGACTTTTTTCCTCAGTTCGATTCTAGACAACCTGACCTCTACCATTGT
CATGGTTTCTTTGCTCAGGAAACTGGTTCCTCAATCAGAATACCGCAAACTTCTAGGAGCTGTTGTGGTGATAGCAGCAA
ATGCAGGAGGAGCATGGACTCCAATTGGTGATGTTACTACAACTATGCTATGGATTCATGGTCAGATATCCACCTTGCCG
ACTATACAGGGCCTTTTCATACCTTCAGCCATTTCTCTTGCTGTTCCGCTAGCACTCATGTCCTTGAGCAGTGAGGTAAA
CGAAAAGGGGCAGGATTCTTCAGATGTATTAGCTTCTGAAAAGATGGCTCCAAGAGGGAAGCTAGTGTTTGGAGTTGGCC
TCGGAGCATTGGTTTTTGTTCCAGTCTTCAAAGCTCTAACTGGATTGCCTCCTTACATGGGCATCTTGCTAGGTCTTGGA
GTTCTCTGGGTCTTGACAGATGCCATCCATTACGGTGAATCAGAAAGACAAAAGCTCAAAGTACCTCAAGCCTTGTCTCG
AATCGACACACAAGGCGCTTTGTTTTTCCTTGGCATCCTTTTATCCGTTAGCAGCCTTGAAGCAGCTGGGATCCTCAGGG
AGATTGCAAACTACCTTGATGCTAATATACCAAACGTTGAGCTAATAGCTAGTGCAATAGGTGTTGTGTCTGCAATCATA
GACAATGTTCCGTTGGTTGCAGCGACCATGGGGATGTACGACCTCACATCCTTCCCTCAAGACTCCGAGTTTTGGCAGCT
GGTTGCGTTCTGCGCCGGTACTGGTGGTTCGATGCTTATCATTGGTTCTGCTGCTGGTGTGGCCTTCATGGGGATGGAGA
AAATTGATTTCTTTTGGTACTTCCGGAAGGTGAGTGGTTTTGCTTTTGCTGGTTATGCTGCTGGTATCGCGGCTTACTTG
GCAATTCAAAGTGTTCATTTTTCGATCCCAACAACGGTGGCTCAGATCCCATTTCTCACTGGTTCGTAA