Details for Kale Locus Bo5g114070

Position : C5 ( 5`- 35122604 .. 35124154 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g114070

Protein [Map View]
MGDTADDQAMVEAPGVPSFSELLMLSDGFLSSSEDHRREINGGDGGEDSFGFVFSGTNGSKMLCFSGDCQNGDESLFQEP
SFPSGVSVSDPSSCTINTCKNSNDTCADERSIKSSNKKRTGSGNGQNMDHNQKPSKKCKKNQDKSTVGIAKVRKERLGER
IAALQQLVSPYGKTDAASVLHEAMGYIKFLQDQIQVLCSPYLINYSLDGGAVTGDVTPGKKVRDLRSRGLCLAPVSSTVH
VENSNGADLWSPATASMGHTMSPSQ*

DNA
ATGGGAGATACAGCAGACGACCAAGCTATGGTGGAAGCTCCCGGAGTCCCGAGCTTCTCGGAGCTTCTTATGTTGTCTGA
CGGGTTTCTTAGCTCCTCTGAAGACCACCGCCGCGAAATTAACGGCGGCGATGGTGGAGAAGACAGCTTCGGTTTTGTAT
TCTCCGGTACAAATGGGTCAAAAATGCTCTGTTTCAGCGGAGACTGCCAAAACGGCGACGAATCGCTCTTCCAAGAACCT
TCTTTTCCTTCCGGAGTATCCGTTTCTGATCCTTCTTCATGCACTATTAACACTTGCAAGAACTCGAATGACACATGTGC
TGACGAGAGATCAATTAAATCTTCAAACAAGAAGAGAACCGGGTCGGGTAATGGGCAAAACATGGATCATAACCAAAAAC
CAAGCAAGAAATGCAAGAAAAATCAGGATAAATCAACAGTTGGAATTGCAAAGGTAAGGAAAGAAAGGTTAGGGGAAAGA
ATTGCAGCGTTGCAGCAATTGGTTTCTCCATACGGAAAGACAGATGCAGCTTCTGTGCTGCATGAAGCGATGGGTTACAT
CAAATTCTTACAAGACCAGATCCAAGTCCTTTGCTCTCCTTACCTAATCAACTATTCTCTTGACGGTGGAGCTGTTACCG
GAGATGTAACGCCGGGGAAGAAAGTGAGAGACTTGAGAAGCAGAGGATTATGCCTAGCACCCGTCTCGTCCACTGTACAC
GTTGAAAACTCCAATGGTGCGGATCTATGGTCACCTGCTACTGCTAGTATGGGTCACACTATGTCACCCTCTCAATGA