Details for Kale Locus Bo5g114060

Position : C5 ( 5`- 35120557 .. 35120891 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g114060

Protein [Map View]
MKKVLRVYGGVLRLVRLLPADTRPYYAKYARENFVNYRDVDVSETPLDELFQRAYNHSIWVLKKYSIDESAAKKLKEICF
E*

DNA
ATGAAGAAGGTGCTCAGAGTATACGGCGGCGTTTTGAGGCTAGTTCGGCTTTTGCCGGCGGACACGAGGCCATACTACGC
CAAGTACGCGAGGGAGAACTTCGTTAACTACCGTGACGTCGACGTAAGCGAAACACCCCTTGATGAACTCTTCCAACGGG
CTTATAATCACTCAATATGGGTACTCAAAAAGTATTCAATCGACGAATCTGCTGCCAAGAAGCTAAAAGAGATTTGTTTT
GAATAA