Details for Kale Locus Bo5g114030

Position : C5 ( 5`- 35077473 .. 35078599 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g114030

Protein [Map View]
MGRTVITKAPKLFLRSWKQVQGRAGISSKAAKPHPMVVDYSEDISHHRVEINRGGEEEWIPHPRTGIFFPPGHESVMDGV
PDGAASFDMTFWLRNIDGVDKPDPDHHFPN*

DNA
ATGGGAAGAACTGTGATCACCAAAGCACCAAAGCTGTTCTTAAGGAGTTGGAAGCAAGTTCAAGGACGCGCAGGGATAAG
CAGCAAAGCTGCAAAACCACATCCTATGGTAGTCGACTACTCTGAAGACATTTCCCATCATAGAGTGGAGATCAACCGTG
GCGGCGAAGAGGAGTGGATCCCACACCCACGTACCGGAATATTCTTTCCGCCAGGACATGAGTCGGTGATGGACGGTGTC
CCTGACGGCGCTGCTTCCTTTGACATGACGTTTTGGCTTAGGAACATTGACGGTGTGGACAAACCTGACCCTGACCATCA
TTTTCCTAACTGA