Details for Kale Locus Bo5g114020

Position : C5 ( 5`- 35072716 .. 35074676 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g114020

Protein [Map View]
MGEETTANDENVAETKPSPKLTLLPLVFLIFYEVSGGPFGVEDSVKSGGGPLLALLGFLIFPLIWSIPEALITAELATSF
PENGGYVVWISSAFGPFWGFQEGFWKWFSGVMDNALYPVLFLDYLKHSFPVLDHVAARVPALLGITFSLTYLNYRGLHIV
GFSAVLLAVFSLCPFLVMALLAVPRIRPQRWLFVDFKKVNWRGYFNTMFWNLNYWDKASTLAGEVESPGETFPKALFGAV
LLVMGSYLIPLTAGTGALSESSSGEWSDGYFAEVGMLIGGVWLKGWIQAAAAMSNLGLFEAEMSSDAFQLLGMSEIGMLP
AFFAQRSKYGTPTISILCSATGVIFLSSLSFQEIIEFLNFLYALGMLLEFAAFVKLRIKKPDLNRPYRVPLNTFGTLSLC
LPPSLLVILVMVLAAPKTFLISGVIIVVGFCLYPFLELVKEKRWARFIPEDPRRQVLGVQTESQLDEEHGDESSASLLP*

DNA
ATGGGTGAAGAGACAACCGCAAACGATGAAAATGTTGCCGAGACAAAACCAAGTCCAAAGCTGACACTATTGCCTCTAGT
ATTTCTAATATTCTATGAAGTTTCTGGTGGCCCTTTTGGTGTGGAGGACTCTGTTAAATCAGGTGGGGGTCCTCTCTTAG
CCCTTCTAGGCTTCTTGATCTTCCCTCTTATCTGGAGCATACCCGAAGCTCTGATCACAGCAGAGCTCGCGACAAGCTTC
CCTGAGAACGGTGGCTACGTGGTTTGGATCTCTTCAGCGTTTGGTCCCTTCTGGGGATTCCAAGAAGGGTTTTGGAAATG
GTTCAGTGGTGTAATGGACAATGCTCTCTACCCTGTTCTGTTTCTTGATTACCTGAAACATTCCTTCCCTGTTTTGGACC
ATGTAGCTGCTCGTGTACCTGCTCTGTTAGGCATTACCTTCTCACTGACGTACTTGAACTACAGAGGGTTGCATATCGTC
GGCTTTTCAGCTGTTCTGTTAGCGGTTTTCTCGCTCTGCCCTTTTCTTGTAATGGCTTTGCTTGCGGTTCCTAGGATCAG
ACCTCAGCGTTGGCTGTTTGTGGATTTCAAGAAAGTTAACTGGAGAGGGTACTTCAATACAATGTTTTGGAATCTGAACT
ATTGGGACAAGGCTAGTACTCTTGCAGGAGAAGTTGAGAGCCCTGGGGAGACGTTTCCAAAGGCTTTGTTTGGAGCGGTT
TTGTTGGTGATGGGGTCGTATTTGATCCCACTTACGGCAGGGACTGGAGCTTTGAGCGAGTCTTCTTCGGGTGAGTGGAG
TGATGGGTATTTTGCTGAGGTTGGGATGCTTATTGGAGGTGTTTGGCTCAAGGGATGGATACAAGCTGCTGCTGCAATGT
CGAATCTAGGATTGTTTGAAGCTGAGATGAGTAGTGATGCGTTCCAGCTTCTTGGTATGAGCGAGATTGGGATGCTCCCT
GCGTTTTTCGCCCAGAGGTCAAAGTATGGTACACCAACGATCAGTATTCTGTGCTCAGCTACAGGAGTCATATTCTTGTC
GTCGTTGAGCTTTCAAGAGATCATAGAGTTTCTGAACTTCTTGTACGCTTTAGGAATGCTTCTTGAGTTCGCAGCCTTTG
TGAAGCTAAGGATCAAGAAACCGGATCTTAACCGACCTTATAGAGTTCCATTAAACACCTTTGGAACTTTATCGCTGTGT
TTGCCTCCTTCTTTGCTTGTGATTCTTGTGATGGTTTTGGCCGCTCCAAAGACGTTTTTAATCAGTGGTGTGATCATCGT
CGTCGGGTTCTGCTTGTACCCGTTCTTAGAACTCGTGAAGGAGAAACGATGGGCGAGATTCATCCCAGAGGATCCAAGAA
GACAGGTTTTAGGAGTTCAAACAGAGTCCCAGTTGGATGAAGAACATGGAGACGAGTCTTCTGCTAGCCTTCTCCCATGA