Details for Kale Locus Bo5g113850

Position : C5 ( 5`- 34947436 .. 34948245 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g113850

Protein [Map View]
MALEAMNCPTNSSSFTARKDRNEPTDDLTNDAVFMEPWLKRKRSKRQRSGSPSSSSSSPPRSRPKSQIQDLAEEEYLALC
LLMLANNHHQPKRRPQESTTKLSHKCSVCGKAFPSYQALGGHKASHRIKPPTTTADDDSTPPTIAVAHPTSTAIAPSGKI
HECSICHKVFPTGQALGGHKRCHYEGTMGGGGGSKSVSQSGSVTSTVSEERSNRAFIDLNLPALPELSLHHHNPVVDEEI
QSPLTGKKPLLLTDHDKASIKKEDFSLRI*

DNA
ATGGCTCTCGAAGCGATGAATTGTCCGACGAATTCTTCTTCGTTCACAGCACGGAAAGATAGAAACGAACCAACAGATGA
TCTTACGAACGACGCCGTTTTCATGGAGCCTTGGCTGAAACGCAAGCGCTCGAAACGCCAGCGTTCTGGCAGCCCTTCCT
CGTCGTCCTCCTCGCCGCCTCGTTCTCGCCCTAAATCTCAAATTCAGGATCTTGCGGAGGAAGAGTACCTCGCTCTCTGT
CTCCTCATGCTCGCCAACAACCACCACCAACCCAAGAGGCGGCCGCAAGAATCCACCACAAAGCTTTCGCACAAGTGCAG
CGTCTGCGGGAAAGCGTTTCCTTCGTACCAGGCTTTAGGCGGCCACAAAGCCAGCCACCGAATAAAGCCTCCAACCACAA
CCGCCGACGACGATTCGACACCTCCAACCATCGCCGTCGCGCATCCGACTTCCACCGCCATCGCACCTTCCGGGAAGATC
CACGAGTGTTCCATCTGCCATAAAGTGTTTCCGACGGGTCAAGCTCTCGGCGGCCACAAACGCTGTCACTACGAAGGAAC
CATGGGCGGCGGCGGAGGAAGCAAATCGGTTAGCCAGAGTGGAAGCGTGACGAGTACGGTTTCGGAAGAACGAAGCAACC
GTGCGTTCATCGATTTAAACCTCCCGGCGTTACCGGAGCTCAGCCTTCATCATCACAATCCAGTCGTCGACGAAGAGATT
CAAAGTCCGTTGACCGGTAAAAAGCCGCTTTTGTTGACCGATCACGACAAAGCCAGCATCAAGAAAGAAGATTTCTCCCT
GAGAATCTAA