Details for Kale Locus Bo5g113790

Position : C5 ( 5`- 34867412 .. 34871539 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g113790

Protein [Map View]
MRGPRPEDFETNPSTPITGQPTPTYPAGARKKGVGVRTWLVLCSRGQAQTTEVGKHAIMRRTGLPARDLRILDPLLSYPS
TVLGRERAIVINLEHIKAIITAQEVLLLNSKDPSVAPFIDELQRRILCHYRATKPKEEENYEGETRMSMDQAQGGGDGTP
LLFGEQGDEAKKDAKQSLENQDGSKVLPFEFVALEACLEAASSSLESEAVRLELEAHPALDKLTSKISTLNLERVRQIKS
RLVAITGRVQKVRDELEHLLDDDEDMAEMYLTEKLAQKLENSLPAESASESNRDESYLRANNDAHDLLMSTHSALSRNSR
GTHTSSTRSAMTNKFDVEELEMLLEAYFVQIDGTLNKLSTLREYVDDTEDYINIMLDDKQNHLLQMGVMLTTATLVMSAF
IAVAGVFGMNINIELFKDEKAGPTRFAWTVIGGFIGSIFLYGEEKRNMSSRRESRDSESKRDRSIFDRESSPKRSRRDGK
PEELGGTDTYEKPRQTLRDAVPLEPDTQGFRKDGEKKHSETTKQAPHLSEGLRSRPYHQHDVRRTTGRDDRRPTSERGSW
RGSRDQSSRRAGDDRRDQDKSTWRHDRFHESDDIKGALSRKRPAFREKKIPGESRNNTNRTRTEDAKDTNLNNRRQNERN
WRSNNERPATGRDRVWNRDDGSRQSYRTDRDGFNRNGRTGLNGSWTRAEKKWDHDLYEEANKSPATANEEEQIAKVEALL
SSS*

DNA
ATGAGAGGCCCTAGGCCGGAAGATTTCGAGACGAATCCATCCACGCCGATCACCGGCCAACCGACGCCGACGTACCCGGC
CGGCGCCCGGAAGAAAGGCGTGGGCGTGAGGACATGGCTGGTGCTCTGCTCGAGAGGCCAGGCGCAGACGACGGAAGTCG
GCAAACACGCCATCATGCGGCGAACGGGGCTACCGGCGCGAGATCTTCGGATCCTCGATCCGCTCCTGTCGTATCCGTCG
ACTGTTCTGGGTAGAGAGAGAGCGATTGTGATCAATCTGGAGCATATCAAGGCGATCATCACGGCTCAGGAGGTTTTGCT
GCTTAACTCGAAGGATCCTTCTGTGGCGCCGTTTATCGATGAGTTGCAGAGGAGGATTCTCTGTCACTATCGCGCTACTA
AGCCTAAGGAGGAAGAGAACTATGAGGGAGAGACTCGTATGAGTATGGATCAAGCGCAAGGAGGAGGAGATGGGACGCCA
TTATTATTTGGGGAACAAGGGGATGAAGCCAAGAAGGATGCGAAGCAAAGCCTTGAGAATCAAGATGGATCCAAGGTTCT
TCCTTTTGAGTTTGTTGCTCTTGAAGCTTGTCTTGAAGCTGCATCCAGCAGTTTGGAAAGTGAGGCCGTAAGATTGGAGT
TAGAGGCTCATCCAGCCTTGGATAAGCTTACTTCGAAGATCAGTACCCTCAACTTGGAGCGGGTTCGACAGATTAAGAGC
AGGCTTGTTGCAATAACTGGACGTGTTCAGAAGGTTAGGGACGAGCTAGAACATCTGCTAGACGACGATGAAGATATGGC
TGAGATGTATCTTACAGAGAAGTTAGCTCAGAAACTTGAGAATTCGCTTCCTGCGGAATCTGCTTCGGAGTCTAACAGAG
ATGAAAGCTACCTTCGAGCAAATAATGACGCCCACGATCTTCTTATGAGTACTCATAGCGCACTTAGCAGAAACAGCCGT
GGGACTCATACTAGCTCAACCAGGAGTGCCATGACCAACAAGTTCGACGTGGAAGAACTTGAAATGCTTCTGGAAGCATA
TTTCGTGCAGATCGATGGTACACTGAACAAACTATCAACACTAAGGGAGTACGTGGATGATACAGAGGATTACATCAATA
TAATGCTAGATGACAAACAGAATCATCTGCTGCAAATGGGTGTGATGCTAACGACAGCAACTCTGGTGATGAGTGCGTTT
ATCGCTGTGGCTGGAGTGTTCGGGATGAACATTAACATAGAGCTGTTCAAGGATGAGAAAGCTGGTCCCACGAGATTCGC
GTGGACTGTGATTGGAGGTTTTATCGGGAGTATATTCCTCTATGGAGAAGAGAAGAGAAACATGTCATCAAGGCGAGAGA
GCAGAGATTCAGAGTCCAAACGAGATCGTTCTATATTCGATCGCGAATCCAGCCCTAAGAGGTCCAGGAGAGATGGGAAA
CCTGAAGAACTTGGTGGTACTGACACATATGAGAAACCACGCCAGACCCTGAGAGATGCTGTGCCACTGGAGCCTGATAC
TCAGGGTTTCAGAAAAGATGGTGAAAAGAAGCACTCTGAGACGACCAAACAAGCTCCCCATCTTTCTGAAGGGCTTCGTT
CTAGACCATACCATCAGCATGATGTTCGTCGTACTACTGGGAGAGATGACAGAAGACCCACTTCTGAGAGAGGATCATGG
AGAGGTTCAAGAGATCAGAGCAGTCGAAGAGCTGGAGATGATCGTAGAGACCAAGACAAAAGCACCTGGCGACACGACAG
GTTCCATGAGAGTGACGACATCAAAGGAGCACTCTCCAGGAAACGCCCTGCCTTCAGGGAGAAGAAGATTCCAGGGGAAT
CTAGGAACAATACAAACAGAACAAGAACTGAGGATGCAAAAGACACAAACCTAAACAATCGCAGACAGAACGAGAGAAAC
TGGAGGAGCAACAATGAGAGACCAGCAACGGGAAGAGACAGGGTGTGGAACAGAGATGATGGAAGCAGACAGAGTTACCG
AACTGATAGAGATGGATTCAACAGAAATGGACGAACTGGGTTAAATGGAAGCTGGACAAGGGCTGAGAAGAAATGGGACC
ATGACTTGTACGAGGAGGCGAACAAGAGTCCTGCTACAGCCAACGAGGAAGAACAGATTGCAAAGGTCGAAGCTTTGTTG
TCTTCTTCTTAA