Details for Kale Locus Bo5g113780

Position : C5 ( 5`- 34857972 .. 34865767 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g113780

Protein [Map View]
MANNPHYPGIQPFQHPNASSINLPRGFAPSMNFQHRPPIQAPQSEQVAHLASQNFQYVGRGGTTMNNGFPPQSYAPQLLQ
SMHHSLERPSQSNQVQHMPLGHPSLISQPNVSVASGTFLPEPYVQTSDINMNGGPRALFSHQSATSFGHLRAPTQVTGPS
SHSQAQQSAPISQDNAPSSIMNPTFVHPKVASSQPIPFQEAATDWVEHTSADGRRYFFNKKTKQSTWEKPVELMTLFERA
DAKTDWKEHSSPDGRKYYYNKVTKQSTWTMPEEMKIARELAENASVQGLHAEGVVHASKVLSRSDTASTAAPAGLPSQTS
STLPTSDTSEKLALTSDWEQAASVPGSSSPVENVDQVQAIADKTSELCDTAKTDNPSATVMITSAATLVDKETVSTENSG
NADDVSAKNTNVLEAKPYFLLACFSPVSVYHNCSSAVQQGSGTGPEESQKHVVENERVDSQSEGKQIHQENFSYTNKSEA
VDVFKSLLKSVNVGSDWTWEQAMREIINDRRYGVLRTLGERKQAFNEFLAQMRKAAEEEKIARQLKRYEDFRRMLEECVE
LTPSTRWSKAVTMLEDDERFKVVEREKDRRNIFEDHISDLKEKERLKAFEDRKRNIVEYRRFLESCNFIKPNSQWRKVQD
RLEVDERCSRLEKIDQLEIFQEYLRDLEREEEERKKIQKEELKKAERKHRDEFRGLIDEHIATGELTAKTSWRDYLVKVK
DLPVYLAIASNSSGATPKELFEDAVEDLKRKYHELKSQIKDVLKLRKVTLSTGSTFDEFRVSVSEGIGSPSIPDFKLKLV
FGDLLERAKEKEEKEARKQTRNTEKLVDMLRSFKYITASSSWEDSKHLVEGTEKFRTIGDESFRKKTFEDYVSHLKEQAK
RIKQNKKEHVREEHDREKDKYGREKERVRERDSRDHRKQSSADNYNHDVDELHGKERRRSGRDSHSRHRERHTSVKENEA
DHYKESHKAGRGHKESRQQRGLVLEAEDEGREKRRRKGESEQTKRAEKEEELEDGECGRY*

DNA
ATGGCTAATAACCCCCACTATCCTGGCATTCAGCCATTCCAGCATCCGAATGCCAGTTCCATAAATTTACCCCGAGGCTT
TGCTCCATCCATGAATTTTCAGCATCGTCCTCCCATTCAAGCTCCGCAGTCCGAGCAAGTTGCTCATTTGGCTTCTCAAA
ACTTTCAATATGTTGGGCGAGGCGGCACAACGATGAACAACGGATTTCCACCTCAATCTTATGCGCCTCAGTTACTACAA
TCAATGCACCATTCGCTTGAAAGACCTAGCCAATCAAATCAGGTGCAACATATGCCACTAGGACATCCGTCTCTAATTTC
ACAGCCAAATGTGTCAGTTGCCTCCGGTACCTTCTTGCCGGAGCCTTACGTACAAACTTCAGATATTAATATGAATGGTG
GCCCTAGGGCACTCTTTTCTCATCAGAGTGCCACATCTTTCGGACATCTGAGGGCACCAACTCAAGTCACTGGACCAAGC
AGTCATAGTCAGGCACAACAAAGTGCACCTATCAGCCAGGATAATGCACCATCTTCTATAATGAATCCAACATTTGTACA
TCCAAAGGTAGCTTCTTCTCAACCTATACCTTTTCAAGAGGCTGCAACAGATTGGGTTGAGCATACCTCGGCGGATGGAC
GGAGATATTTTTTCAACAAGAAGACGAAGCAGTCCACTTGGGAGAAGCCTGTTGAGTTGATGACTCTATTTGAGAGAGCA
GATGCAAAAACTGACTGGAAAGAACATTCAAGTCCTGATGGAAGAAAGTATTATTATAATAAGGTTACCAAGCAATCAAC
ATGGACAATGCCTGAGGAGATGAAGATTGCTCGTGAACTAGCAGAAAATGCATCTGTTCAAGGGCTGCATGCAGAAGGCG
TTGTTCATGCTTCTAAGGTGCTGTCTCGTTCTGATACAGCATCGACTGCAGCTCCGGCTGGTTTACCAAGCCAAACATCA
TCTACACTTCCAACATCTGATACCAGTGAGAAACTAGCTCTTACTTCTGATTGGGAGCAGGCAGCGTCAGTTCCTGGAAG
CTCTTCCCCGGTCGAAAATGTTGATCAAGTTCAGGCAATTGCAGATAAAACATCAGAACTGTGTGATACTGCAAAAACTG
ATAATCCTTCTGCCACTGTGATGATAACTTCTGCTGCTACATTGGTTGACAAGGAAACAGTATCAACCGAGAACAGTGGA
AATGCAGATGACGTGTCAGCTAAAAACACAAATGTACTTGAAGCTAAGCCCTATTTCTTGTTAGCATGCTTTTCCCCTGT
ATCTGTTTATCACAATTGTTCATCTGCTGTCCAGCAAGGTAGTGGGACTGGACCAGAGGAAAGCCAAAAACATGTGGTGG
AAAATGAAAGAGTTGACAGTCAGTCGGAAGGAAAACAGATTCATCAAGAGAATTTTTCTTATACCAACAAATCGGAAGCT
GTGGATGTCTTCAAATCACTTTTGAAATCTGTCAATGTTGGATCTGACTGGACATGGGAGCAGGCCATGAGAGAAATAAT
TAATGATAGAAGATACGGGGTTTTGAGGACTCTTGGAGAGCGGAAGCAAGCCTTCAATGAGTTTCTAGCTCAAATGAGAA
AAGCAGCAGAGGAGGAAAAGATAGCAAGACAGCTAAAACGATATGAAGATTTTAGAAGGATGTTAGAGGAATGCGTGGAG
CTTACTCCTTCTACTCGGTGGAGCAAGGCTGTGACTATGTTGGAAGACGATGAGCGTTTCAAAGTTGTTGAACGAGAAAA
AGACCGTCGTAATATTTTTGAAGATCATATCAGTGACTTAAAGGAGAAGGAGCGGTTGAAAGCTTTTGAGGATCGCAAGC
GGAACATTGTTGAATACAGGAGATTTTTGGAATCTTGCAATTTCATTAAGCCTAATAGCCAATGGCGCAAAGTTCAGGAC
CGTTTAGAAGTGGATGAAAGATGTTCACGTCTTGAGAAAATTGATCAGCTAGAAATATTTCAGGAGTATCTGCGCGATCT
GGAGAGAGAAGAAGAGGAGAGAAAGAAGATACAGAAGGAAGAACTAAAAAAAGCAGAGCGAAAGCATCGTGATGAGTTCC
GTGGTCTGATAGATGAACATATTGCTACAGGAGAGCTTACTGCCAAAACTAGTTGGCGTGATTATTTAGTGAAGGTCAAA
GATTTACCAGTATATTTAGCAATTGCATCGAACTCCTCTGGCGCTACACCAAAAGAGTTATTTGAAGATGCTGTTGAGGA
TTTGAAAAGAAAGTACCACGAGCTCAAATCTCAGATAAAGGACGTATTGAAGCTGAGAAAGGTAACGTTATCCACTGGAT
CAACGTTTGATGAGTTCAGAGTCTCAGTTTCTGAGGGTATCGGTTCCCCATCTATTCCTGACTTTAAACTGAAGTTAGTG
TTTGGTGATTTGCTGGAAAGAGCAAAGGAGAAGGAAGAGAAGGAAGCCAGAAAACAGACTCGGAATACTGAAAAATTGGT
GGATATGCTTCGCTCCTTCAAGTATATAACTGCCTCTTCATCCTGGGAGGATTCTAAGCATCTTGTTGAAGGTACTGAAA
AATTCCGTACCATAGGGGACGAGAGCTTCCGGAAGAAGACATTCGAGGATTACGTTTCGCACCTGAAAGAGCAAGCAAAA
AGGATCAAACAGAACAAGAAGGAACATGTTAGAGAGGAACATGACAGGGAGAAGGATAAATACGGAAGAGAGAAGGAGAG
AGTGAGAGAAAGAGACAGTAGAGATCATCGTAAGCAAAGTTCAGCTGATAATTACAACCATGACGTGGACGAACTCCATG
GAAAAGAACGTAGAAGATCGGGAAGAGATAGCCACAGTAGACATCGAGAAAGACATACTAGTGTGAAGGAAAATGAGGCA
GACCATTACAAAGAATCTCATAAAGCTGGTCGTGGCCATAAGGAATCAAGACAACAGCGAGGTTTGGTGCTGGAAGCCGA
GGATGAAGGAAGGGAAAAGCGGCGTAGAAAAGGAGAGAGTGAGCAAACAAAGCGTGCGGAAAAGGAAGAGGAGCTTGAAG
ATGGAGAATGTGGTAGGTACTAA