Details for Kale Locus Bo5g113730

Position : C5 ( 5`- 34736467 .. 34737998 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g113730

Protein [Map View]
MDPCSFVRIIVGNLAVRFPAPSSSSSSEPSVSGISNSSTSAPNCYCKIKFKSFPRQIVSAPVIFRTESESETRCSTVAAC
FSLSKSQIKASLNKPKLNVLSIETYSRGEGVTGASCGLASASEKLLGRFEVSLDLKAAETKTCLAHNGWVALRGKRRNKT
GSDPELHVSVRVEPDPRFVFQFYGEPECSPQVFQVQGNTKQAVFTCKFGARNSGSGDRNLLHSSSMMSETRSSCISSMKS
EKEQPSKERKGWSVTVHDLSGSPVAMASMVTPFVPSPGSNRVTRSSPGAWLILRPDGCTWKPWGRLEAWREAGYSDALGY
RFELFQDGIATEVSASSSISLKNGGSFVIDVTGGTTTAGSTPTTSPQGSLDLGSGSSSGSRPASRPGSGSGSDFGYLLPK
HPAQSRGFVMSASVEGVGKQSKPKVEVGVTHVTCTEDAAAHVALAAAVDLSLDACRLFSQKLRKELRQQSQLGVV*

DNA
ATGGATCCGTGCTCTTTCGTACGGATCATAGTCGGGAACTTAGCCGTTAGATTCCCGGCGCCGTCTTCTTCTTCTTCATC
TGAACCGTCTGTTTCCGGAATCAGTAATTCCTCCACATCAGCTCCTAACTGCTACTGCAAAATCAAATTCAAGAGCTTCC
CTCGCCAAATCGTCTCTGCTCCGGTTATCTTCCGAACCGAATCTGAATCCGAGACGCGTTGCTCAACCGTCGCAGCTTGC
TTCAGTCTAAGCAAATCTCAGATCAAGGCATCTTTGAATAAGCCTAAGTTAAACGTCCTCTCCATCGAGACTTACTCACG
CGGTGAAGGCGTTACTGGCGCGTCGTGTGGACTCGCTTCCGCGAGTGAGAAGCTGCTCGGACGGTTCGAGGTTTCGCTGG
ATTTGAAAGCTGCGGAGACGAAGACGTGTTTGGCGCATAACGGATGGGTCGCTTTGAGGGGGAAAAGGAGGAATAAGACT
GGATCGGATCCGGAGCTCCACGTTAGCGTGCGGGTTGAACCCGACCCGAGATTCGTGTTTCAGTTCTACGGCGAGCCAGA
GTGTAGCCCTCAGGTTTTCCAAGTACAAGGAAACACCAAACAAGCCGTGTTCACTTGCAAGTTCGGCGCTAGAAACTCCG
GTTCCGGCGATCGGAATCTTCTTCACAGTTCGTCAATGATGTCTGAAACGAGGAGTAGTTGCATATCTTCGATGAAATCG
GAGAAGGAACAGCCTTCGAAGGAGAGAAAAGGTTGGTCGGTAACGGTCCATGATCTCTCCGGGTCACCCGTAGCGATGGC
CTCCATGGTAACACCTTTCGTTCCATCCCCCGGTTCGAACCGCGTGACGCGATCGAGTCCCGGCGCGTGGCTTATTCTCC
GACCCGACGGTTGCACGTGGAAGCCATGGGGACGACTAGAGGCCTGGCGTGAAGCTGGTTACTCAGACGCACTCGGTTAC
CGTTTCGAGCTCTTCCAAGACGGAATCGCCACCGAGGTCTCCGCATCGTCGTCTATAAGTTTGAAAAATGGCGGGAGTTT
TGTTATTGACGTCACCGGCGGGACAACCACCGCGGGATCCACGCCGACAACGAGTCCTCAGGGAAGTTTGGATCTCGGAT
CCGGTTCCAGCTCCGGGTCGAGACCCGCGTCGAGACCAGGATCAGGATCCGGGTCGGATTTTGGATATCTACTGCCGAAG
CATCCGGCGCAGAGCAGAGGGTTCGTGATGTCGGCTTCGGTGGAAGGAGTGGGGAAACAGAGCAAACCGAAGGTGGAAGT
CGGCGTGACGCACGTGACATGCACGGAGGATGCAGCAGCGCACGTGGCGTTAGCTGCGGCGGTGGATCTGAGTTTGGATG
CTTGCAGGCTGTTTTCTCAGAAGCTAAGGAAAGAGCTGAGACAGCAAAGCCAGCTTGGTGTCGTTTGA