Details for Kale Locus Bo5g113690

Position : C5 ( 5`- 34719584 .. 34720855 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g113690

Protein [Map View]
FRFHALEDISRKPSHSLKNIAKDEFERNFVSALVAHGEIGVKFDDIGSLEHVKKTLNELVILPMRRTELFTRGNLLRIYS
ISLHYFIFLKARFFLDDLSLFVFPRRAKAYCYLVLLVLVRRFAKALATEAGANFISITSSSLTSKWFGDAEKLTKDLFSF
ASKLVPPVIIFVEEVDSLLDACGGSSEHESTRMMRNEFMTAWDGFRSKDSQRILILGATSRPFDLDRLPRRIYVDLPDEE
NRLKILNIILNQENIETGFEFEKLAKETEGVGKVSG

DNA
TTTAGATTTCACGCACTAGAAGATATTTCCCGCAAGCCTTCACATAGCTTGAAGAATATAGCAAAGGATGAGTTTGAAAG
AAACTTTGTCTCAGCTTTAGTTGCTCATGGTGAAATTGGTGTCAAGTTTGACGACATTGGTTCTCTCGAACATGTGAAGA
AGACACTGAATGAGTTGGTTATACTTCCCATGAGAAGGACAGAGCTCTTCACCCGTGGGAATCTCTTGCGGATATATTCC
ATTTCTCTTCATTATTTTATCTTCTTAAAAGCTAGATTCTTCTTAGATGACTTGAGTCTTTTTGTTTTTCCCAGACGTGC
AAAGGCATATTGCTATTTGGTCCTCCTGGTACTGGTAAGACGTTTCGCCAAAGCCCTTGCTACAGAGGCTGGAGCAAACT
TCATTAGCATAACTAGCTCATCGCTTACATCAAAGTGGTTTGGAGATGCAGAGAAGCTCACGAAAGATTTGTTCTCATTT
GCAAGCAAACTAGTGCCGCCCGTGATTATTTTTGTCGAAGAGGTTGACAGTTTGTTAGACGCTTGTGGTGGTTCTAGCGA
GCATGAATCAACTCGGATGATGAGAAACGAGTTCATGACAGCTTGGGATGGATTCAGGTCAAAAGATAGCCAAAGGATAC
TCATCCTCGGTGCCACCAGCAGACCATTTGATCTTGATCGTCTACCAAGAAGGATATATGTCGATTTACCAGATGAGGAG
AACCGGTTGAAGATTTTGAATATTATTTTGAATCAAGAAAATATTGAAACAGGTTTTGAGTTTGAGAAACTTGCAAAAGA
AACTGAAGGTGTTGGGAAAGTTAGCGGA