Details for Kale Locus Bo5g113670

Position : C5 ( 5`- 34713626 .. 34715594 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g113670

Protein [Map View]
MENNTDVSIHDFLERMRKPSAGDLVKSIKSFIVSFLNNEPDPEKDSAAVQDFFSKMEAAFRAHPLWSGCSEDELDSAGDG
LEKYVMTKLFPRVFASNTEDVISDEKLFQKMSLVQQFISPEYLDIKPTFQNETSWLLAQKELQKINMYKAPRDKLVCVLN
CCKVINNLLLNASIASNENTPGADEFLPVLIYVTIKANPPQLHSNLLYVQRYRRESKLVGEAAYFFTNILSAESFISNID
AKSLSMDEAEFEKNMESARARISGLSSQSTAPPPPPPPRDESTVHKTQMLNPKRETTLFQSRSSDSLSGTSDILNANSEI
PMKKAESVSDLENKGAARLLKDTEASKIFQEYPYLFANAGDLRIGDVEGLLNSYKQLVFKYVCLSKGLGDAATTSLASSS
TPPLQALSGFDTSKEPEDHTMASSDVKETDRSVDDLVRALQGVGEAVVDKVLDVKQEEYTSVLAEEQT*

DNA
ATGGAGAACAACACGGACGTTTCGATTCATGATTTCCTGGAGCGGATGCGTAAACCCTCCGCCGGCGATCTCGTTAAATC
AATCAAAAGTTTCATTGTTTCATTCTTGAACAATGAGCCAGACCCAGAAAAGGATTCTGCTGCAGTTCAAGACTTCTTTT
CCAAGATGGAAGCTGCTTTCAGGGCTCATCCACTTTGGTCCGGTTGTTCTGAGGATGAACTAGACAGCGCTGGAGATGGT
TTAGAGAAGTATGTCATGACAAAGCTGTTTCCCCGTGTCTTTGCTTCAAACACCGAGGACGTTATATCTGATGAGAAACT
CTTTCAGAAGATGTCCTTGGTTCAACAGTTCATTTCTCCTGAGTATTTGGATATAAAACCAACTTTTCAAAACGAAACAT
CCTGGCTGCTAGCTCAGAAAGAGCTCCAGAAGATAAACATGTACAAAGCTCCTCGTGATAAGCTCGTGTGTGTCCTTAAC
TGCTGCAAAGTGATTAATAACTTACTCCTAAACGCTTCCATTGCTTCTAATGAGAATACGCCTGGAGCCGACGAGTTTCT
TCCTGTCTTGATATATGTTACAATAAAGGCTAATCCTCCACAGCTTCACTCAAACCTGTTGTATGTACAAAGATATAGGC
GTGAATCTAAACTTGTTGGTGAAGCTGCCTACTTCTTCACAAACATACTCTCTGCAGAGTCTTTCATCTCAAATATCGAT
GCGAAATCACTTTCAATGGATGAAGCTGAGTTTGAGAAGAACATGGAATCTGCACGGGCACGAATCTCTGGTTTAAGCAG
CCAGTCTACTGCACCACCACCACCACCACCCCCACGTGACGAGTCCACTGTTCATAAAACTCAAATGCTGAATCCCAAGA
GAGAAACAACTCTTTTCCAGTCGAGATCGTCTGACAGTCTCTCTGGAACCAGTGACATACTCAACGCCAACAGTGAAATA
CCAATGAAGAAAGCTGAATCCGTATCTGATTTGGAAAACAAGGGTGCTGCAAGGCTTCTGAAGGATACTGAGGCAAGCAA
AATCTTCCAAGAATACCCTTACTTATTTGCAAACGCTGGTGATTTGAGGATAGGAGATGTTGAAGGCTTGTTAAATAGCT
ATAAACAGCTCGTGTTCAAATATGTGTGCCTTTCCAAAGGATTGGGTGATGCAGCAACAACATCTTTAGCTTCTTCATCA
ACTCCACCCTTGCAAGCTTTGTCCGGTTTTGATACGTCTAAGGAACCTGAGGATCATACCATGGCATCTTCAGATGTAAA
GGAAACTGACAGGAGCGTGGATGATCTGGTCCGAGCTCTACAGGGTGTAGGGGAAGCTGTCGTTGATAAGGTCTTAGATG
TAAAACAAGAAGAGTATACATCAGTTTTGGCAGAAGAACAAACATGA