Details for Kale Locus Bo5g113540

Position : C5 ( 5`- 34647330 .. 34648383 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g113540

Protein [Map View]
MSLLCSSSRVAPPLSQTKLSSPRFLKLKTRTLTLCSSISYTNVRKHISYMFAESHKFGRLTKSQILVSPESFTENSTIDM
DWEDQEDVEDTGSPWEGSIMYRRNASVTHVEYCTTLERLGLGKLSTEVSKKRASSMGLRVTKDVKDFPDGTPVQVSVDVI
RKKKKLRLDGIVRTVITLGCNRCGEEAGESIFSNFSLLLTEEPVEEPDVIDLGFTFGNDKANSFSLDDGEEDEDEDDEID
WEDKLHFPPEVKEVDISKHIRDLVHLEITMNAICDPACKGMCLKCGANLNKRKCDCGSEEKDKGYGPLGNLRKQMQQKEG
LRN*

DNA
ATGTCTCTGCTTTGCTCTTCATCTCGTGTAGCTCCCCCCTTGTCACAGACCAAACTGTCAAGTCCACGTTTTCTGAAACT
CAAAACACGTACCTTAACTCTATGTTCTTCCATCAGCTACACTAATGTCAGGAAGCACATCAGTTACATGTTCGCAGAAT
CACATAAGTTTGGTAGGCTAACAAAGAGTCAGATACTAGTTAGTCCGGAGTCTTTTACAGAGAACAGCACAATAGATATG
GATTGGGAAGATCAAGAGGACGTGGAGGATACCGGTTCACCATGGGAAGGTTCGATTATGTACCGGAGAAATGCTTCAGT
CACACACGTTGAATACTGCACCACCTTAGAGAGGCTTGGGTTGGGGAAGCTGTCTACTGAGGTCTCGAAGAAGAGGGCTT
CTTCGATGGGACTTAGAGTGACAAAAGATGTCAAGGATTTTCCGGACGGGACACCCGTTCAAGTTTCGGTTGATGTCATA
AGGAAGAAGAAGAAGCTGAGACTCGATGGGATTGTCAGGACCGTTATCACACTTGGCTGCAACAGATGCGGTGAGGAAGC
AGGTGAGAGCATCTTCTCCAACTTCTCGTTGTTACTAACCGAAGAGCCAGTTGAAGAACCGGATGTCATTGATCTAGGAT
TCACTTTCGGTAATGACAAAGCCAATTCCTTTTCTTTGGACGACGGAGAAGAAGATGAGGATGAGGATGATGAGATAGAT
TGGGAGGATAAGCTCCATTTTCCACCTGAGGTGAAAGAAGTAGATATCTCAAAGCATATAAGAGACTTGGTGCATTTAGA
GATCACCATGAACGCTATATGTGATCCTGCGTGTAAAGGAATGTGCTTGAAGTGCGGTGCGAATCTGAATAAGAGGAAGT
GTGATTGTGGCAGTGAAGAGAAGGATAAAGGATATGGACCTCTTGGGAACCTGAGAAAGCAAATGCAACAGAAAGAGGGT
CTTAGAAACTAA