Details for Kale Locus Bo5g112490

Position : C5 ( 5`- 34574613 .. 34576403 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g112490

Protein [Map View]
MSDLQAPLVRPKRKKTWVDYFVKFRWIIVIFVVLPISATLYFLIYLGDMWSESKSYEKRRKEHDQNVAKVIKRLKERDAA
KDGLVCTARKPWIAVGMRNVDYKRARHFEVDLGEFRNILEINKEKMIARVEPLVNMGQISRATVPMNLSLAVVAELDDLT
VGGLINGYGIEGSSHLYGLFADTVVAYEIVLAGGELVRATKDNEYSDLFYAIPWSQGTLGLLVAAEIKLIPVKEYMRLTY
IPVKGDLQTLAQGYMDSFAPKDGDTSKIPDFVEGMVYNPTEGVMMVGTYASKEEAKKKGNKINNVGWWFKPWFYQHAQTA
LKKGEFVEYIPTREYYHRHTRCLYWEGKLILPFGDQFWFRFLFGWLMPPKVSLLKATQGEAIRNYYHDMHVIQDMLVPLY
KVGDALEWVHREMEVYPIWLCPHKLYKAPIKQQIYPEPGFEYERRQGDTEDAQMYTDVGVYYAPGPVLRGEEFDGSEAVR
KMEKWLIENGGFQPQYAVSELDEKSFWRMFDGDLYEHCRKKYRAVGTFMSVYYKSKKGRKTEKEVREAEQAHLETAYAEA
D*

DNA
ATGTCGGATCTTCAAGCACCGCTCGTAAGGCCCAAGAGAAAGAAGACATGGGTCGACTACTTCGTCAAGTTCAGATGGAT
CATCGTCATCTTCGTCGTCCTCCCAATCTCAGCCACGCTCTACTTCCTCATCTACCTCGGAGACATGTGGTCAGAGTCCA
AATCCTACGAGAAACGCCGCAAGGAACACGACCAGAACGTCGCCAAAGTCATCAAACGCCTCAAGGAGAGAGACGCCGCC
AAGGACGGACTCGTCTGCACCGCGCGCAAGCCTTGGATCGCCGTCGGGATGAGGAACGTCGACTACAAGAGAGCGCGACA
CTTCGAGGTAGACTTGGGAGAGTTCCGCAACATCCTAGAGATCAACAAGGAGAAAATGATCGCTAGAGTTGAGCCTCTCG
TCAACATGGGACAGATCTCTCGCGCTACCGTCCCCATGAACCTCTCTCTCGCTGTTGTCGCTGAGCTTGATGATCTCACC
GTTGGTGGACTCATTAACGGTTACGGTATTGAAGGAAGCTCTCACCTCTACGGTCTCTTTGCAGATACCGTCGTGGCTTA
CGAGATTGTTCTAGCTGGTGGTGAACTTGTCCGTGCTACTAAGGATAACGAGTACTCTGATCTCTTCTACGCGATCCCTT
GGTCTCAAGGAACTCTCGGGCTCCTTGTTGCAGCCGAGATCAAGCTTATACCGGTTAAGGAGTACATGAGACTCACTTAC
ATACCGGTTAAAGGAGATCTTCAAACCTTAGCTCAAGGCTACATGGACTCATTCGCGCCTAAAGATGGAGACACGTCGAA
GATCCCTGACTTCGTCGAAGGCATGGTTTACAATCCGACGGAAGGTGTGATGATGGTTGGAACATACGCGTCTAAAGAAG
AGGCCAAGAAGAAAGGGAACAAGATCAACAACGTTGGGTGGTGGTTCAAGCCGTGGTTCTACCAGCACGCGCAGACCGCG
CTGAAGAAGGGGGAGTTTGTTGAGTATATTCCTACTCGTGAGTACTACCATAGGCACACGAGGTGCTTGTACTGGGAAGG
GAAGCTGATTCTTCCTTTTGGTGATCAGTTTTGGTTTAGGTTCCTCTTTGGTTGGTTGATGCCTCCAAAGGTCTCTCTTC
TTAAGGCCACTCAAGGTGAAGCTATCAGAAACTATTACCATGATATGCATGTGATTCAGGACATGCTTGTTCCTCTTTAC
AAGGTTGGTGATGCTCTCGAATGGGTCCACCGCGAAATGGAGGTGTATCCGATTTGGCTTTGCCCGCACAAGCTCTACAA
GGCACCAATCAAACAGCAGATTTACCCTGAGCCAGGTTTTGAGTACGAGAGGAGACAAGGAGACACTGAAGATGCTCAGA
TGTACACTGACGTTGGAGTGTACTACGCACCAGGTCCTGTCCTAAGAGGTGAAGAGTTTGATGGATCGGAAGCTGTGCGT
AAGATGGAGAAATGGCTGATAGAGAACGGCGGGTTCCAGCCTCAGTACGCTGTGTCTGAGCTTGATGAGAAGAGCTTCTG
GAGGATGTTTGATGGTGACTTGTACGAGCATTGCCGCAAGAAGTATAGAGCAGTTGGAACGTTCATGAGTGTTTACTACA
AGTCGAAGAAAGGAAGGAAGACTGAGAAAGAAGTTAGAGAAGCAGAGCAAGCTCATCTCGAAACAGCTTATGCTGAGGCA
GATTAA