Details for Kale Locus Bo5g112470

Position : C5 ( 5`- 34558269 .. 34563722 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g112470

Protein [Map View]
MEGENVTEPLNTAAPSTGEGIFATAPPPSDSVLATAASSVSPSSKSQPEQSSMSIAVSQSVSSSLTAQSSANPIPQAPHM
LQNPPFGRPGTLAPPGLMTSPPAFPGSNPFSTIPRPGGPAQINPGIHPHMYPPYHSMPPMHGTPQGMWLQPRPMDGIPRA
HFPSHPTPFHGNYPFPVRGASPHLPYPGSQPLPVGNTGTVHALPGHQPLDVPPGQKPEALSGIDDRAGSQLVGNRVDAWT
AHKSETGVVYYYNSVTGQSTYEKPPGFEREPDKVPVQPIPISMENIHGTDWALVSTNDGKKYYYNNKTKVSSWQIPPEVK
DLVKKTEERSTESLVSVPSADLTEKGSEQSSLSAPAINNGGRDAVSLRTTIVPGFSALDLVKKKLHDSGVPVSSTTTSEA
NGGKSNEVTPSGESGDGMGKVKDAPGGGDLSDSTSDSEDEDSGPSKEECIKQFKEMLKERGVAPFSKWEKELPKIIFDPR
FKAIQSHSVRRSLFEQYVKTRAEEERREKRAAHKAAVEGFKQLLDEASKAHFFLLNRVPLYFWATLRDIFLFFFGFGCFL
TRTSLVGIYYHPDIFQDIDKHTDYHIFKKKWGNDLRFESLERKEREALLNERILSLKRAADQKAQEIRAAAASDFKTMLH
EREVSINSHWSKVKDSLRNDPRYRSAAHEDREVFYNEYIAELKAARGDDYEMKSRGEEDKLRERERELRKRKEREVLEVE
RVRQKIRRKEAVASYQALLVEKIRDPEASWTESKPKLERDPQKRALNPDLDPADKEKLFRDHIKTLYERCARDFKALLVE
VLSSEAASQQTEEAKTVLNSWSTAKQVLKSDIRYSKMPRDDREVIWRRYAEDILRKQKQDSPQKEEKPRDYKI*

DNA
ATGGAAGGGGAGAATGTAACGGAGCCGTTGAATACGGCTGCGCCATCTACGGGAGAGGGTATCTTCGCCACAGCTCCTCC
TCCAAGTGATTCAGTATTGGCTACTGCTGCATCGAGTGTCTCTCCAAGCAGTAAATCTCAGCCGGAGCAATCCTCTATGT
CTATTGCTGTCTCTCAATCAGTTTCATCTTCCCTTACTGCGCAGTCGAGTGCTAATCCCATACCCCAAGCCCCGCATATG
CTGCAAAATCCGCCTTTTGGTCGACCAGGAACACTCGCTCCTCCTGGACTCATGACATCTCCGCCTGCTTTTCCTGGTTC
CAACCCCTTTTCCACAATTCCAAGGCCCGGGGGTCCTGCTCAAATCAATCCTGGTATCCATCCACACATGTATCCTCCTT
ATCATTCTATGCCACCAATGCATGGAACGCCCCAAGGAATGTGGTTGCAGCCTCGACCCATGGATGGTATTCCCAGGGCA
CATTTCCCTTCACATCCTACTCCTTTTCATGGTAATTACCCATTTCCTGTTCGTGGAGCTTCTCCTCACCTGCCATATCC
TGGTTCTCAACCGCTTCCTGTGGGGAATACTGGCACTGTTCATGCGTTACCGGGCCACCAACCGTTAGATGTTCCTCCTG
GTCAAAAGCCAGAAGCACTCTCAGGAATTGATGACAGAGCTGGTTCTCAACTAGTAGGAAATCGAGTAGATGCCTGGACT
GCACATAAATCAGAAACAGGAGTTGTTTACTATTATAATTCGGTGACAGGCCAATCGACCTATGAAAAGCCTCCTGGTTT
TGAAAGGGAGCCTGATAAAGTGCCGGTGCAGCCAATTCCTATCTCTATGGAGAATATACATGGGACGGATTGGGCTCTTG
TTTCCACAAATGATGGCAAAAAATATTACTACAACAATAAAACAAAGGTAAGTAGCTGGCAGATTCCACCTGAGGTGAAA
GATTTGGTGAAGAAAACGGAGGAGAGGTCAACGGAGAGTTTAGTTTCTGTGCCGAGCGCTGATTTAACTGAAAAGGGTTC
TGAGCAATCAAGTTTGAGCGCACCTGCTATTAACAATGGTGGCCGGGATGCCGTATCGCTCAGAACTACAATTGTTCCTG
GTTTCTCAGCGTTAGATTTGGTTAAAAAGAAACTGCATGATTCTGGAGTGCCTGTCTCCTCTACGACAACATCTGAAGCA
AATGGTGGTAAATCAAACGAGGTCACACCTAGTGGAGAGAGTGGAGATGGTATGGGCAAGGTAAAAGATGCTCCTGGAGG
TGGTGACCTTTCTGATTCTACTTCAGATTCCGAAGATGAAGATAGTGGACCATCGAAGGAAGAGTGTATCAAACAGTTTA
AGGAAATGCTCAAGGAGAGAGGAGTGGCACCGTTTTCTAAATGGGAGAAGGAACTGCCAAAAATTATCTTTGACCCTCGC
TTTAAGGCAATTCAAAGTCATTCTGTTCGAAGATCTTTATTTGAGCAGTACGTAAAGACTCGTGCTGAAGAAGAACGTAG
GGAAAAGCGTGCTGCTCATAAGGCAGCTGTTGAAGGTTTCAAGCAGTTGCTGGACGAAGCGTCTAAGGCACATTTTTTTT
TACTTAACCGAGTTCCTCTTTACTTTTGGGCTACCTTACGTGACATTTTTCTTTTCTTTTTTGGTTTTGGATGTTTCTTA
ACCCGTACTTCACTTGTGGGAATTTATTATCATCCTGATATTTTTCAGGACATTGATAAACACACTGATTATCATATTTT
TAAAAAGAAATGGGGAAATGATCTGCGGTTCGAATCACTTGAGCGGAAGGAAAGAGAAGCTTTGCTGAATGAAAGAATCC
TTTCTTTGAAACGAGCTGCTGACCAGAAGGCGCAAGAAATCCGCGCAGCAGCAGCCTCTGATTTCAAGACGATGTTACAT
GAAAGAGAAGTGTCCATAAATTCACATTGGTCCAAGGTAAAGGATAGCCTGAGAAATGATCCAAGATATAGATCTGCTGC
ACACGAGGACAGGGAGGTCTTTTATAATGAGTACATTGCGGAATTAAAAGCTGCAAGGGGAGATGATTATGAGATGAAAA
GTAGAGGCGAAGAGGATAAACTGAGAGAACGAGAGCGGGAGTTGCGAAAACGGAAAGAAAGAGAAGTGCTAGAGGTGGAA
AGGGTACGACAAAAAATCAGAAGGAAAGAGGCAGTCGCCTCTTATCAGGCTTTGCTAGTGGAGAAGATCAGAGACCCTGA
GGCATCCTGGACAGAATCGAAGCCGAAACTTGAGAGGGATCCACAAAAACGCGCCTTAAATCCGGATTTAGACCCTGCTG
ATAAAGAGAAGCTGTTCCGAGACCATATAAAGACATTGTACGAGAGGTGTGCCCGTGACTTCAAAGCTCTTCTAGTTGAA
GTCTTGTCATCGGAAGCTGCTTCTCAGCAGACGGAAGAAGCAAAGACCGTGCTCAACTCTTGGTCGACGGCTAAACAAGT
ACTCAAATCCGACATCCGATACAGCAAGATGCCCAGAGATGACAGGGAAGTCATATGGCGCAGATATGCCGAAGATATCT
TGAGGAAACAGAAACAAGATAGCCCTCAAAAGGAAGAGAAACCAAGAGATTACAAGATCTAA