Details for Kale Locus Bo5g112420

Position : C5 ( 5`- 34525158 .. 34526215 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g112420

Protein [Map View]
MLSLQQPCMLWLNLYVHLRVCVLVKSSHCFADPERPKNDKATILTDTVQLLKELTSEVNKLKSEYSALADESREILNLDH
KLQKSTGDLYNQGQCLRGELQWSHDGSTAIFSISNAYGHASWVNANASINAILHVLGNQNPSMMPAAPCNLEQRFQERAD
PRKQRTLMMLQHNLSLKLLVLLLIRTHHCKGQRRRRDLRDIATNSIEESPLSSKCSSSPSVRVRDDSPSDSVTDGQKPE*

DNA
ATGCTTAGTTTACAACAACCATGTATGCTCTGGTTAAATCTTTATGTGCATTTAAGAGTTTGTGTTTTGGTTAAATCCTC
ACACTGTTTTGCAGATCCAGAAAGACCCAAGAACGACAAAGCCACCATTCTGACTGATACTGTTCAGTTGTTGAAAGAGC
TCACATCAGAAGTCAACAAACTTAAATCTGAGTACAGTGCATTGGCAGACGAGTCCCGAGAGATACTAAATCTAGACCAT
AAGTTGCAAAAATCTACAGGTGATTTGTATAACCAAGGTCAATGTCTCCGTGGGGAGCTGCAATGGAGTCATGATGGCTC
CACCGCCATCTTCTCCATATCCAATGCCTATGGCCATGCCTCCTGGGTCAATGCCAATGCATCCATCAATGCCATCTTAC
ACGTACTTGGGAACCAGAACCCTAGCATGATGCCAGCAGCTCCATGTAACCTAGAACAAAGGTTTCAAGAGAGAGCAGAT
CCGAGAAAGCAGAGGACTCTAATGATGTTGCAACACAACTTGAGTTTAAAACTCCTGGTTCTACTTCTGATAAGGACACA
TCATTGCAAAGGCCAGAGAAGACGAAGAGATCTCAGAGATATAGCAACAAACTCCATAGAAGAAAGCCCTCTTTCTAGCA
AATGCTCATCTTCTCCGAGCGTTCGTGTACGTGACGACAGTCCTTCCGATAGTGTAACGGATGGCCAAAAACCTGAGTGA