Details for Kale Locus Bo5g112410

Position : C5 ( 5`- 34517816 .. 34518261 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g112410

Protein [Map View]
MGRNLLAMNVMWKLDVANMLKCWGAVSHIRNSLAKSKERPRIEKAVSIFIDMDSTGGANEWIYK*

DNA
ATGGGGCGTAATCTCCTTGCAATGAATGTCATGTGGAAACTTGATGTAGCCAACATGTTGAAATGTTGGGGAGCAGTCTC
ACATATCCGTAACAGCCTAGCAAAATCGAAGGAGCGACCACGGATAGAGAAGGCTGTGAGCATTTTCATAGACATGGATT
CAACAGGGGGAGCAAACGAATGGATTTACAAGTAG