Details for Kale Locus Bo5g112380

Position : C5 ( 5`- 34486834 .. 34489285 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g112380

Protein [Map View]
MPMENDNDHAANVVLTAEQASKVNDTAVRLPENLQTGVVSESGGGSEKGAEAVETAVAEDVDESGSNTVGELPPRSSSAR
VPFTNLSQIDADLALARTLQEQERAYMMLTMNSEVSDYGSWETGSYVYEEDDEYETDDDPQGDAPDVNAHEDEGRNADEE
EVGYSDDEAFARAIQEAEEREMADRLSALTGLANRVEDPEEDDHTSQDAWDEMDPDELSYEELLALGDIVGTESRGLSAD
TIASLPSKIYKDGDNQNGTNESCVICRLDYEDDDDLILLPCKHSYHSECINNWLKINKSCPVCSAEVSTSTAGQS*

DNA
ATGCCCATGGAGAACGACAATGACCACGCCGCCAACGTCGTCCTCACCGCCGAGCAAGCGAGCAAGGTTAACGACACTGC
CGTACGGTTGCCGGAGAATCTTCAGACCGGCGTCGTCTCAGAATCCGGAGGTGGAAGCGAGAAAGGAGCGGAAGCGGTGG
AGACGGCGGTGGCGGAGGATGTGGATGAGAGCGGATCGAATACGGTGGGAGAGCTACCTCCCCGATCTTCCTCAGCGAGA
GTTCCGTTCACTAATCTGAGCCAGATTGATGCGGATCTTGCCCTCGCTCGCACGCTCCAAGAACAGGAGCGGGCGTATAT
GATGCTGACTATGAACAGTGAAGTCAGTGACTATGGGAGCTGGGAAACTGGAAGCTATGTATACGAAGAGGATGACGAGT
ACGAAACAGATGATGATCCTCAGGGAGATGCGCCAGATGTTAACGCTCATGAAGATGAAGGCAGGAATGCTGACGAAGAA
GAAGTTGGGTATTCAGATGACGAAGCCTTTGCTAGAGCTATTCAGGAAGCTGAGGAAAGGGAAATGGCAGATAGGTTGTC
TGCCTTAACTGGGTTAGCAAATCGGGTTGAAGATCCAGAGGAGGATGATCATACTTCTCAGGATGCCTGGGATGAGATGG
ATCCTGATGAGCTTTCATATGAGGAGTTGCTTGCGCTTGGCGATATTGTGGGAACCGAGAGTAGAGGGCTGTCTGCTGAT
ACAATTGCATCTTTGCCTTCAAAAATATATAAAGATGGAGACAATCAGAACGGAACCAATGAATCTTGTGTTATATGTCG
TCTGGACTATGAGGATGACGATGACTTGATACTTCTTCCATGCAAACATTCTTACCACTCGGAGTGCATAAATAACTGGT
TGAAGATAAACAAGAGTTGCCCGGTATGCAGCGCAGAAGTTTCAACTTCCACAGCTGGACAAAGCTAA