Details for Kale Locus Bo5g112360

Position : C5 ( 5`- 34470959 .. 34471930 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g112360

Protein [Map View]
MSSGGNSTASTAPAVEKMFFCYQCNRTVNISISVSSAADPFCPLCSGGFLEEYDEPVPTLPPNLNPESGFFPMADPFSTL
LPLLFGSSSAPPSSTNPSFFGPRSTQNQPQGGAFDPVSFLQNHLQHLQSSGTHVQFLIEDHPLDPSNRAPGHVGDYFFGP
GLEQLIQQLAENDPNRYGTPPASKSAIEGLPTVKVSKDMLKSEMNQCAVCMDEFEDGGDVKQMPCKHVFHQDCLMPWLEL
HNSCPVCRYELPTDDPDYESRGQGQGGQTSGDGGQTPRSFSVQLPWTFGGRRDGSGSGAPGSGGGGGGGGGGSNLGTRQE
DLD*

DNA
ATGTCTTCCGGCGGAAACTCAACTGCCTCCACCGCCCCCGCGGTCGAAAAGATGTTCTTTTGCTACCAGTGCAACCGCAC
AGTCAACATCTCAATCTCAGTCTCCTCCGCCGCTGATCCTTTCTGCCCTCTTTGCTCCGGCGGCTTTCTTGAAGAATACG
ACGAACCCGTCCCTACTCTACCCCCGAATCTCAATCCCGAATCCGGTTTCTTCCCCATGGCGGATCCTTTCTCCACCTTG
CTCCCTCTCCTCTTCGGCTCCTCCTCCGCTCCTCCTTCCTCCACAAACCCGAGCTTCTTCGGACCCCGCTCTACCCAGAA
CCAGCCTCAAGGCGGCGCCTTTGATCCGGTTTCCTTCCTCCAGAACCATCTCCAGCATCTCCAATCCAGCGGCACGCACG
TGCAGTTCTTGATCGAGGATCATCCTCTGGATCCGTCTAACCGAGCCCCGGGGCATGTCGGGGACTACTTCTTCGGCCCT
GGTCTCGAGCAGCTGATTCAGCAGCTAGCGGAGAATGATCCCAACCGCTACGGAACTCCTCCTGCTTCGAAATCGGCTAT
CGAAGGGCTGCCGACTGTTAAGGTGAGTAAGGACATGTTGAAGTCTGAGATGAACCAGTGTGCTGTTTGTATGGATGAGT
TTGAGGATGGCGGCGATGTGAAGCAGATGCCTTGCAAGCATGTGTTTCATCAGGATTGTTTGATGCCGTGGCTGGAGTTG
CATAACTCTTGTCCCGTTTGTCGGTATGAGTTGCCTACGGATGATCCTGATTATGAGAGCAGGGGTCAGGGGCAAGGAGG
TCAGACGAGTGGGGATGGTGGGCAGACTCCGAGGAGCTTTAGTGTACAGCTTCCTTGGACGTTTGGTGGGAGACGGGATG
GTTCAGGGTCAGGAGCACCTGGAAGTGGTGGTGGTGGAGGTGGAGGTGGAGGTGGGTCCAATCTTGGGACCAGGCAGGAA
GATTTGGACTGA