Details for Kale Locus Bo5g112350

Position : C5 ( 5`- 34458238 .. 34464346 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g112350

Protein [Map View]
MAQKVSPSMQSLKSLPADYRFDGENSSFGLTNSSIPRQGGLRNGVSQADTAAGDSDDSPYSSRHGVSVEEQSLTDDVEPG
AATMPLPQNDERRWSDTSAYARKKILQSWVQLPNGNWELGKILSTSGEESVISLPEGKVMKVISETLVPANPDILDGVDD
LMQLSYLNEPSVLYNLNYRYNQDMIYTKAGPVLVAVNPFKEVPLYGNRYIEAYRKKSNESPHVYAIADTAIREMIRDEVN
QSIIISGESGAGKTETAKIAMQYLAALGGGSGIEYEILKTNPILEAFGNAKTLRNDNSSRFGKLIEIHFSESGKISGAQV
QTFLLEKSRVVQCAEGERSYHIFYQLCAGASPALREKLNLTSAHEYKYLGQSNCYSINGVDDAERFHSVKEALDIVHVSK
EDQESVFAMLAAVLWLGNVSFTVIDNENHVEPVADESLSTVAKLIGCNINELKLSLSKRNMRVGKDTIVQKLTLPQAIDA
RDALAKSVYSCLFDWLVEQINESLAVGKRRTGRSISILDIYGFESFDKNSFEQFCINYANERLQQHFNRHLFKLEQEEYI
QDGIDWTRVDFEDNQDCLSLFEKKPLGLLSLLDEESTFPNGTDLTLANKLKQHLHSNSCFRGDREKLFTVVHYAGEVTYD
TTGFLEKNRDLLHLDSIQLLSSCSCHLPRAFASSMLIQSEKPVVGPLYKAGGADSQRLSVATKFKGQLFQLMQRLGNTTP
HFIRCIKPNNVQSPGLYEQGLVLQQLRCCGVLEVVRISRSGFPTRVSHQKFARRYGFLLVENIADKDPLSVSVAILHQFN
ILPEMYQVGYTKLFFRTGQIGVLEDTRNRTLHGILRVQSSFRGYQARCHLKKLKMGISILQSFVRGDKVRKEFAELRRRH
RAAATIQSQVKSKIARKQYKGITEASLVIQSAIRGWLVRRCSGDIGWLKSGGTKTNESGEVLVKASVLSDLQRRVLKSEA
ALREKEEENDILQQRLQQYENRWSEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSS
NQFKSQASNGGGGRQQQQPMSAGLSVIGRLAEEFEQRAQVFGDDAKFLVEVKSGQVEANLNPERELRRLKQMFETWKKDY
GGRLRETKMILSKLGSEESGGSMEKVKRKWWGRRNSTRY*

DNA
ATGGCCCAAAAGGTATCTCCATCCATGCAGTCTCTTAAATCTTTGCCCGCAGACTACAGATTTGATGGTGAAAATTCTAG
TTTTGGCTTGACCAATTCTAGTATTCCAAGACAAGGCGGTTTAAGGAATGGTGTTAGTCAAGCTGATACTGCAGCTGGAG
ATAGTGATGATTCACCATATAGTAGTAGGCATGGTGTTTCTGTTGAAGAGCAGTCTTTAACTGATGATGTGGAGCCTGGT
GCTGCTACAATGCCCTTACCTCAGAATGATGAACGCAGGTGGAGCGACACTAGTGCATATGCAAGGAAGAAGATACTGCA
ATCTTGGGTTCAACTTCCAAATGGTAACTGGGAGCTTGGGAAGATACTGTCAACTTCAGGAGAAGAGTCTGTTATCTCTT
TGCCTGAGGGAAAAGTTATGAAAGTTATATCAGAGACTCTGGTACCTGCAAATCCTGATATTCTTGATGGAGTGGATGAT
CTAATGCAACTAAGTTACTTAAATGAGCCATCAGTGTTGTACAATCTCAACTATAGGTACAACCAAGACATGATATATAC
AAAAGCAGGGCCAGTTTTGGTGGCTGTGAATCCTTTCAAGGAGGTTCCTTTGTATGGAAATCGATACATAGAAGCATACA
GGAAGAAATCAAATGAAAGTCCTCATGTGTATGCAATTGCAGATACAGCAATTCGTGAAATGATACGCGATGAGGTTAAC
CAATCTATCATTATCAGCGGCGAGAGTGGAGCAGGGAAAACTGAGACAGCTAAGATAGCTATGCAGTACTTGGCTGCTCT
TGGAGGTGGAAGCGGGATTGAATATGAGATACTTAAGACTAATCCCATTTTGGAAGCATTTGGAAATGCAAAAACTTTGA
GAAATGATAACTCTAGTCGTTTTGGAAAGCTGATAGAGATTCATTTTAGTGAAAGCGGAAAGATATCGGGTGCTCAAGTT
CAAACCTTCTTACTAGAAAAGTCTAGAGTGGTCCAATGTGCTGAAGGAGAAAGGTCATACCATATATTTTACCAACTTTG
TGCTGGGGCTTCACCTGCACTTAGAGAGAAGCTAAATCTGACAAGCGCACATGAGTACAAATATTTGGGACAGAGTAATT
GTTATTCAATCAATGGAGTTGATGATGCTGAACGTTTTCATAGTGTTAAGGAAGCTCTGGACATTGTTCATGTTAGTAAA
GAAGATCAAGAAAGTGTGTTCGCAATGCTTGCTGCAGTGTTATGGCTGGGGAATGTTTCCTTCACCGTTATTGACAATGA
AAACCATGTTGAGCCTGTGGCAGATGAAAGTTTGTCAACTGTTGCTAAATTAATTGGGTGCAACATCAATGAGCTTAAGC
TAAGTTTATCGAAACGTAACATGAGAGTTGGAAAAGATACCATTGTGCAGAAGCTAACACTACCGCAGGCCATTGATGCA
AGAGATGCTTTAGCAAAATCGGTTTATTCGTGCCTGTTTGACTGGCTGGTTGAACAGATCAACGAGTCTCTTGCAGTGGG
GAAGAGGCGAACTGGCAGATCCATCAGCATTCTTGATATCTATGGCTTCGAATCATTTGATAAAAATAGTTTTGAGCAGT
TCTGTATAAATTATGCAAATGAGAGATTACAGCAACACTTTAACCGTCATCTATTCAAGCTGGAGCAAGAGGAATATATC
CAGGATGGTATCGACTGGACAAGGGTTGATTTTGAAGACAACCAAGATTGTCTCAGTCTCTTTGAAAAGAAACCATTGGG
GCTGCTTTCTCTTTTGGACGAGGAATCAACATTTCCGAATGGCACAGATCTGACACTTGCAAACAAGTTAAAACAGCATC
TTCACTCTAATTCATGTTTCAGAGGAGATCGAGAGAAGCTTTTCACAGTTGTGCATTATGCAGGAGAGGTTACATATGAC
ACAACAGGATTTCTAGAGAAGAACAGAGACCTGTTGCACTTGGATTCTATTCAGCTTTTGTCCTCTTGCTCCTGCCACCT
TCCTCGAGCGTTTGCTTCTAGCATGCTGATCCAATCTGAAAAACCTGTAGTCGGTCCTTTGTACAAAGCAGGTGGTGCTG
ATTCCCAGCGGTTGAGTGTAGCTACCAAATTTAAGGGTCAACTATTCCAATTGATGCAACGTTTAGGGAACACTACCCCA
CATTTCATTCGTTGCATCAAGCCAAATAACGTTCAGTCTCCAGGGTTGTATGAGCAAGGACTTGTCTTACAGCAGCTAAG
ATGTTGTGGGGTCTTAGAAGTTGTTCGAATCTCACGGTCTGGATTTCCTACAAGAGTGTCTCATCAGAAATTTGCCAGAA
GGTATGGTTTCCTTCTGGTGGAGAACATTGCTGATAAAGATCCTCTAAGTGTCTCAGTTGCGATCCTCCATCAGTTCAAT
ATCTTGCCGGAGATGTACCAAGTTGGCTACACGAAGTTGTTTTTCAGAACCGGCCAGATTGGGGTTCTTGAAGATACAAG
GAACCGTACACTCCATGGCATTTTACGTGTACAAAGCTCTTTTAGAGGATACCAAGCACGTTGTCACCTGAAGAAGCTTA
AAATGGGAATTTCTATTCTCCAGTCATTTGTTCGTGGAGATAAAGTAAGAAAGGAGTTTGCCGAGTTACGAAGGAGGCAT
AGGGCTGCAGCTACTATACAAAGCCAAGTTAAAAGCAAGATTGCTAGGAAACAGTATAAGGGCATAACAGAAGCTTCTCT
TGTGATACAATCAGCAATTCGTGGTTGGTTGGTTAGAAGATGCTCAGGGGACATTGGATGGTTAAAATCTGGAGGCACTA
AGACAAATGAGTCAGGCGAGGTGCTAGTAAAGGCATCTGTACTTTCCGACCTTCAACGCAGGGTACTCAAATCGGAAGCT
GCTCTGCGTGAGAAAGAAGAGGAGAACGACATTCTTCAGCAGAGGCTTCAACAGTACGAGAACCGTTGGTCAGAGTACGA
GACAAAGATGAAATCAATGGAAGAAATCTGGCAGAAGCAAATGCGGTCATTGCAATCTAGCCTCTCCATAGCAAAGAAAA
GCCTAGCGGTCGAGGACTCTGCTAGAAACTCGGATGCATCGGTCAATGCAAGCGACGCAACGGATTGGGATTCAAGCAGT
AATCAGTTCAAGAGTCAGGCAAGCAACGGAGGAGGGGGGAGACAACAACAACAGCCTATGAGTGCTGGTCTTAGTGTGAT
TGGACGGTTGGCGGAGGAGTTTGAACAGAGAGCTCAAGTTTTTGGTGATGATGCTAAGTTCTTGGTGGAAGTGAAGTCTG
GTCAGGTGGAAGCAAACTTGAACCCGGAGAGAGAGCTGAGGAGGTTGAAACAGATGTTTGAGACGTGGAAGAAGGATTAT
GGAGGGAGGTTGAGGGAAACGAAGATGATACTGAGCAAACTTGGGAGTGAAGAGAGTGGCGGTTCGATGGAGAAGGTGAA
GAGGAAGTGGTGGGGAAGGAGGAATAGCACTAGGTATTGA