Details for Kale Locus Bo5g112300

Position : C5 ( 5`- 34413469 .. 34415054 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g112300

Protein [Map View]
MSYLSGSIQRPLVAAAAVIAASVSADVSDKFSSLRSLVRGSEPEPIAASVSGSVQDEKSLWVSHISASKLADLSFMSRIR
LIVPNVNHLAPNPSCNLAPSVTSLPALRSAYQSAELAKASKPAAFTTGASLVVPDVSYKWHLPETGAVDLSGSSRCALEK
NRTVVVLLGWLGSKQKHMKKYAEWYTSRGYHVITFTLPMNEIMSYQVGGKAEKNIESLVNHLADWLDEEQHKNLVFHTFS
NTGWLTYGAILEKFQKQDSSLMGRVKGCIVDSAPVAAADPTVWASGFSAAFLKKNSVATKGSGSSSFESNMGARINFSEP
KPAATETALLMILEKFFAVILNLPKVNRRLADVLETLSSSQPRCPQLYIYSSADRVIPAGQVESFIVEQRKAGHEVRACN
FISSPHVDHFRSNPQLYTAELNHFMDNFVLACCNHSS*

DNA
ATGAGTTATTTGTCTGGGAGTATCCAACGGCCACTTGTTGCTGCTGCAGCTGTTATCGCCGCTTCTGTCTCTGCAGATGT
CTCTGACAAGTTCTCCTCTCTTAGATCACTTGTTCGAGGTTCTGAACCAGAGCCTATTGCTGCTTCAGTGTCTGGTTCGG
TTCAGGACGAAAAGTCATTATGGGTTTCTCATATCTCAGCCTCCAAGCTCGCTGATTTATCTTTCATGTCCAGGATTCGT
CTCATTGTACCAAACGTTAATCACCTAGCTCCTAACCCCAGCTGTAATCTCGCTCCTTCTGTTACTTCGTTGCCCGCTCT
TCGTAGCGCTTATCAGTCTGCGGAGTTGGCTAAGGCATCAAAACCAGCAGCATTCACAACTGGGGCCTCTCTTGTTGTTC
CTGATGTTTCTTACAAATGGCATTTGCCCGAGACTGGTGCAGTTGATCTCTCTGGCTCCTCGAGATGTGCATTGGAGAAG
AATAGGACCGTTGTGGTTTTGCTGGGATGGCTTGGATCGAAGCAGAAGCATATGAAGAAATATGCGGAATGGTATACTTC
AAGGGGTTACCATGTGATCACGTTTACTCTCCCCATGAATGAGATTATGAGCTACCAAGTTGGAGGAAAAGCAGAGAAGA
ACATCGAGTCGCTGGTTAATCATTTGGCTGATTGGTTGGATGAAGAGCAACATAAGAATCTCGTCTTTCATACCTTCAGC
AACACCGGATGGTTAACATATGGAGCCATTTTGGAAAAGTTTCAGAAGCAAGATTCTTCATTGATGGGAAGGGTTAAAGG
TTGCATAGTGGACTCAGCTCCTGTTGCTGCTGCTGATCCTACTGTATGGGCATCAGGTTTCTCCGCCGCATTCTTGAAGA
AAAACAGTGTAGCCACTAAAGGATCCGGAAGCTCGTCATTTGAGTCAAACATGGGAGCACGTATAAACTTCTCCGAGCCT
AAACCCGCTGCAACAGAAACAGCTTTGCTTATGATTCTGGAGAAGTTCTTCGCGGTGATTCTTAATCTTCCCAAAGTAAA
CAGGAGACTAGCTGATGTTCTAGAGACTTTATCATCATCACAACCAAGATGTCCACAGTTGTACATTTACAGCTCTGCGG
ATAGAGTTATACCCGCGGGGCAAGTTGAGTCATTCATTGTAGAACAGAGGAAAGCAGGACACGAGGTCCGTGCCTGCAAC
TTCATATCTTCACCTCATGTAGACCATTTCAGGAGTAACCCACAGCTTTATACAGCTGAGCTCAACCATTTCATGGACAA
CTTTGTCCTTGCCTGTTGCAACCATTCTTCATAG