Details for Kale Locus Bo5g111260

Position : C5 ( 5`- 34367574 .. 34368988 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g111260

Protein [Map View]
MLLPLFFLLLLNLHLSSSYSISFPDFQIIDVLQPLTVTGTLPDFNNTDESKYTLRLLHRDRFPSVSYRNHHHRLHARMRR
DTDRVAAILRRISGKTVAAGSKYEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQ
SDPVFDPAKSGSYTGVSCGTVIRNVAMGCGHRNRGMFVGAAGLLGIGGGSMSFVGQLTGQTGGAFGYCLVSRGTDSTGSL
VFGREALPVGASWVPLVRNPRAPSFYYVGLKGLGVGGVRIPLPDDVFDLTETGDGGVVMDTGTAVTRLPTAAYAAFRDGF
KSQTANLPRASGVSIFDTCYDLSGFVSVRVPTVSFYFTEGPVLTLPARNFLMPVDDSGTYCFAFAASPTGLSIIGNIQQE
GIQVSFDGANGFVGFGPNVC*

DNA
ATGCTGCTTCCTCTCTTCTTCCTCCTCCTCCTCAATCTCCATCTCTCTTCTTCCTATTCAATCTCCTTCCCTGATTTTCA
GATCATCGACGTTCTACAACCGCTCACCGTCACCGGAACCCTTCCCGATTTCAACAACACCGATGAGTCTAAGTACACTC
TTCGTCTCCTCCACCGCGATAGATTCCCTTCTGTTTCTTACCGTAACCACCACCACCGTCTCCACGCCCGTATGCGCAGA
GACACAGACCGAGTCGCCGCCATCCTCCGCCGCATTTCCGGGAAAACTGTAGCTGCCGGTTCGAAATACGAAGTCGACGA
CTTTGGCTCCGATGTGGTTTCCGGCATGGACCAAGGGAGCGGTGAGTACTTCGTCAGAATCGGCGTCGGAAGTCCGCCGC
GAGATCAGTACATGGTGATTGACTCCGGGAGCGACATGGTTTGGGTCCAGTGTCAGCCTTGCAAGCTCTGTTACAAACAA
TCCGACCCGGTTTTCGACCCGGCTAAATCCGGGTCCTACACCGGAGTCTCCTGCGGGACTGTGATTCGAAACGTAGCGAT
GGGATGCGGACACCGGAACAGAGGGATGTTCGTCGGAGCCGCCGGTTTATTAGGTATCGGAGGCGGTTCGATGTCTTTCG
TTGGTCAGTTAACCGGTCAAACCGGCGGTGCGTTTGGTTATTGTTTAGTGAGCCGCGGCACAGACTCGACCGGTTCGTTG
GTTTTCGGGCGTGAAGCTTTGCCAGTTGGTGCCTCGTGGGTCCCGCTCGTCCGTAACCCGCGCGCGCCGAGCTTCTACTA
CGTTGGTCTCAAGGGCCTCGGAGTTGGCGGCGTCAGGATCCCTTTACCGGACGATGTTTTCGACTTAACCGAAACCGGCG
ACGGCGGTGTGGTTATGGACACCGGAACCGCCGTTACTAGACTTCCCACGGCGGCTTACGCTGCGTTCCGAGATGGGTTC
AAGTCTCAGACGGCAAACTTGCCGCGAGCTTCTGGCGTATCGATATTCGACACGTGTTACGACCTGTCCGGGTTTGTCTC
GGTCCGAGTTCCGACCGTGTCGTTCTATTTCACGGAAGGTCCGGTTTTGACCTTACCGGCGAGGAATTTCTTAATGCCGG
TGGATGATTCGGGGACGTACTGTTTCGCGTTTGCGGCGTCTCCGACTGGTTTGTCGATAATAGGGAACATACAGCAAGAA
GGGATCCAAGTATCTTTCGACGGAGCCAATGGCTTTGTTGGGTTTGGTCCCAATGTTTGCTAG