Details for Kale Locus Bo5g111250

Position : C5 ( 5`- 34352409 .. 34355917 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g111250

Protein [Map View]
MQSGGDYTNGFHGGLQRDEKQVPVLSSLGRAKRRSRGGARDPRGGLTNGELRVSDQISEQKPLESQESPPPCTDFDVAYF
HSYAHVGIHEEMIKDRARTETYREAIMQHQSLIQGKVVVDVGCGTGILSIFCAQAGAKRVYAVDASDIAVQANEVVKANG
LSDKVIVLHGRVEDVEIDEEVDVIISEWMGYMLLYESMLGSVITARDRWLKPGGLILPSHATLYMAPISHPDRYSHSIDF
WRNVYGIDMSAMMQLAKQCAFEEPSVESISGETVLTWPEVVKHIDCQTIKIQELDSVTARYKFKSMMRAPMHGFAFWFDV
EFSEPAKNTNATSVANRSSSISPFTEGNQKKRSNPNDALVLSTSPEAPPTHWQQTIVYFYDPIDVEQDQVIEGSVTLSQS
KENRRFMNIHLEYTSAGRSFVKESVMR*

DNA
ATGCAATCTGGCGGCGATTACACCAACGGTTTCCACGGCGGGCTTCAACGGGACGAGAAGCAAGTCCCCGTTCTCAGCTC
TCTTGGCCGAGCCAAGAGGCGCAGTCGCGGCGGAGCTCGTGACCCTAGAGGCGGTCTCACCAATGGTGAGCTTAGGGTTT
CCGACCAGATTAGCGAGCAGAAGCCACTGGAGAGCCAGGAATCTCCTCCGCCTTGTACCGACTTCGATGTCGCCTATTTT
CATTCCTATGCTCACGTTGGGATTCACGAAGAGATGATCAAGGATCGGGCGAGGACGGAAACGTATAGAGAAGCTATAAT
GCAGCATCAGAGCTTAATCCAAGGAAAGGTTGTGGTGGACGTTGGCTGTGGAACAGGCATCCTTTCAATCTTCTGTGCCC
AAGCGGGTGCTAAACGGGTATATGCTGTAGATGCAAGTGATATTGCAGTCCAGGCAAATGAAGTTGTAAAAGCCAACGGT
TTATCTGACAAGGTTATTGTTTTGCATGGGAGAGTGGAGGATGTTGAAATCGACGAGGAGGTTGATGTTATAATTTCAGA
GTGGATGGGTTACATGCTCTTGTATGAGAGCATGCTGGGAAGTGTTATTACAGCTAGAGATCGCTGGTTGAAGCCTGGAG
GTTTAATTCTCCCATCACATGCCACTTTGTACATGGCACCTATTTCACACCCTGACAGATACAGTCACAGCATTGATTTT
TGGCGCAACGTTTATGGAATTGATATGTCTGCAATGATGCAACTAGCAAAACAGTGTGCATTTGAAGAACCTAGCGTGGA
GTCCATATCAGGCGAAACCGTTCTAACATGGCCCGAAGTGGTTAAACATATAGACTGTCAAACAATAAAAATCCAAGAGC
TAGACTCTGTTACTGCAAGATACAAATTCAAGTCAATGATGAGAGCACCAATGCATGGTTTTGCATTTTGGTTTGACGTT
GAGTTCAGTGAACCTGCCAAGAATACTAATGCAACAAGCGTTGCTAATAGGTCCTCATCAATAAGTCCTTTTACCGAAGG
AAATCAGAAGAAGCGGAGTAATCCGAATGATGCACTCGTGCTGTCCACCTCTCCTGAGGCTCCTCCGACGCATTGGCAGC
AAACGATTGTATATTTCTATGATCCAATAGACGTAGAGCAAGACCAAGTCATTGAAGGTTCCGTTACTCTTTCTCAAAGT
AAAGAGAATCGGAGGTTCATGAACATCCACCTCGAATATACCTCGGCCGGCCGTTCCTTTGTGAAGGAGTCGGTAATGCG
TTAA