Details for Kale Locus Bo5g111240

Position : C5 ( 5`- 34342127 .. 34345619 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g111240

Protein [Map View]
MSISAQNPDISGERQSGQDVRTQNVMACQAVSNIVKTSLGPVGLDKMLVDDIGDVTITNDGATILRMLEVEHPAAKVLVE
LAELQDREVGDGTTSVVIVAAELLKRANDLVRNKIHPTSIISGYRLAMREACKYIEEKLVTKVEKLGKAPLINCAKTSMS
SKLISGDSDFFANLVVDAVLSVKMTNQRGEIKYPIKGINILKAHGQSAKDSYLLNGYALNTGRAAQGMPLRVSPAKIACL
DFNLQKTKMQLGVQVVVNDPRELEKIRQREADMTKERIEKLLKAGANVILTTKGIDDMALKYFVEAGAIAVRRVRKEDMR
HVAKATGATLVTTFADMEGEETFDPAHLGSADEVVEERIADDDVVLIKGTKTSSAVSVILRGANDYMLDEMERALHDSLC
IVKRTLESNTVVAGGGAVESALSVYLEHLATTLGSREQLAIAEFADALLIIPKVLAVNAAKDATELVAKLRAYHHTAQTK
ADKKHYSSMGLDLVNGTIRNNLEAGVIEPAMSKVKIIQFATEAAITILRIDDMIKLVKEDGQGDE*

DNA
ATGTCGATCTCCGCTCAAAATCCTGATATTTCCGGCGAAAGGCAATCCGGCCAAGATGTCCGTACTCAGAACGTGATGGC
TTGTCAAGCTGTTTCAAATATTGTTAAAACCTCCCTTGGTCCCGTCGGACTAGACAAGATGTTGGTGGATGATATTGGTG
ATGTGACCATTACAAATGACGGTGCTACCATTCTTAGGATGTTGGAGGTCGAACACCCTGCTGCTAAGGTTCTTGTTGAG
TTAGCTGAACTCCAGGATAGAGAAGTTGGTGATGGCACTACATCTGTTGTTATTGTTGCTGCTGAGTTGCTCAAGAGGGC
AAATGATTTGGTTAGGAACAAAATACATCCTACATCAATTATCAGTGGATACAGGCTAGCGATGAGAGAAGCTTGCAAAT
ACATTGAGGAGAAATTGGTAACTAAGGTCGAAAAGCTTGGGAAAGCTCCATTGATTAACTGTGCTAAAACAAGCATGTCC
TCCAAACTGATCTCTGGTGACAGTGACTTCTTTGCCAATTTGGTTGTGGATGCAGTTCTGTCAGTTAAGATGACAAATCA
GCGAGGGGAGATAAAATACCCTATCAAGGGGATTAATATCCTGAAAGCTCATGGACAAAGTGCAAAAGACAGCTATTTGT
TGAATGGATATGCACTCAACACTGGCCGTGCTGCCCAAGGGATGCCATTGCGAGTTTCTCCAGCGAAGATTGCTTGCCTC
GACTTTAATCTTCAGAAGACGAAAATGCAGCTGGGTGTCCAAGTTGTTGTAAACGACCCACGAGAACTTGAAAAAATTCG
TCAAAGAGAAGCTGACATGACCAAAGAGCGGATAGAGAAACTTCTTAAAGCTGGGGCCAATGTTATTCTGACCACCAAGG
GAATTGACGACATGGCACTTAAATACTTTGTAGAGGCAGGAGCTATTGCTGTTAGGCGTGTCCGCAAAGAAGACATGCGC
CATGTTGCCAAAGCAACAGGAGCAACTCTGGTTACCACTTTTGCTGACATGGAGGGCGAAGAAACATTTGATCCGGCACA
CCTTGGATCTGCAGACGAAGTTGTGGAGGAGAGAATCGCAGATGATGATGTTGTGCTGATAAAGGGAACTAAAACAAGCA
GTGCGGTTTCCGTGATCTTGAGAGGTGCGAACGACTACATGCTTGATGAGATGGAGAGAGCGCTTCACGATTCTTTATGT
ATTGTGAAGAGGACCCTCGAATCCAACACGGTGGTTGCAGGTGGAGGTGCAGTTGAATCAGCATTGTCTGTGTATTTGGA
GCACCTTGCTACAACCTTGGGCTCTCGTGAACAATTGGCAATTGCTGAATTTGCAGATGCGCTACTGATTATACCGAAGG
TACTTGCAGTAAACGCTGCCAAGGATGCAACGGAGCTGGTAGCTAAACTAAGAGCATACCACCACACCGCACAAACCAAG
GCTGATAAGAAGCACTATTCAAGCATGGGACTTGACCTTGTCAACGGAACCATCCGTAACAATTTGGAAGCTGGAGTGAT
CGAACCAGCGATGAGCAAAGTGAAAATCATCCAGTTTGCGACAGAGGCAGCCATTACCATTCTGCGAATTGATGACATGA
TCAAACTGGTGAAGGAAGATGGCCAAGGCGATGAGTAA