Details for Kale Locus Bo5g111230

Position : C5 ( 5`- 34340332 .. 34341630 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g111230

Protein [Map View]
MAAVNGYQGNTPAETTPAAAGSKQPAPPNKTVDSQSVLKRLQSELMGLMMGGDPGISAFPEEDNIFCWKGTITGSKDTVF
EGTDYRLSLSFSNDYPFKPPKIKFETCCFHPNVDLYGNICLDILQDKWSSAYDVRTILLSIQSLLGEPNISSPLNNQAAQ
LWSNQEEYRKMVEKLYKPLNA*

DNA
ATGGCGGCGGTGAATGGGTACCAAGGAAATACTCCGGCGGAGACAACGCCGGCAGCCGCCGGATCGAAGCAACCTGCTCC
TCCGAATAAGACCGTCGATAGCCAATCCGTTCTCAAAAGGCTGCAATCTGAACTAATGGGTTTAATGATGGGAGGTGATC
CAGGGATATCGGCTTTCCCAGAGGAAGACAACATATTCTGCTGGAAAGGAACAATCACAGGAAGCAAAGATACTGTGTTT
GAAGGAACTGACTACAGACTCTCACTCTCTTTCTCCAACGATTATCCTTTCAAACCTCCCAAAATTAAGTTTGAGACTTG
CTGCTTCCACCCCAATGTGGATCTCTATGGCAATATTTGCTTGGACATTCTTCAGGATAAATGGTCGTCCGCTTATGATG
TGAGGACGATATTGCTCTCAATTCAAAGCCTTCTTGGAGAACCGAACATCAGCTCACCATTGAACAATCAAGCAGCTCAG
CTTTGGAGCAACCAAGAAGAGTATAGGAAGATGGTGGAGAAGCTCTACAAACCTTTAAACGCATGA