Details for Kale Locus Bo5g111150

Position : C5 ( 5`- 34316389 .. 34317826 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g111150

Protein [Map View]
MEALYAKLYNKYTTLKERKFSELDEVNKKQEEKFLRFVDASEALTQHLRSEDQNSKEIIRRMRDEISEIRSARHEERLEF
QNRLAEEERKNKALSEQVEKLKELISEGVPQSGRKQKTPQVTTRSMGKRRRLTEDDIVETDMVSPHVSIPHESTTETLLV
SQPQCSKTADVGSSSSAGSPFQALSEQLTGMKLSTNNEGERVCIIASHPSSGLSFSLTLVDNSTGEEAELLYNVVSLGTF
ERVVPNWMRDVIKFNTSMTPLFFERVSRVIKPRD*

DNA
ATGGAAGCTCTGTACGCCAAGCTCTACAACAAATACACCACCCTCAAGGAGAGGAAATTTTCGGAATTGGATGAAGTTAA
TAAGAAACAAGAAGAGAAGTTCCTTCGCTTTGTTGATGCGTCAGAGGCCCTGACGCAGCATTTGAGAAGTGAAGACCAGA
ATTCGAAGGAGATCATAAGGAGAATGAGGGATGAGATAAGTGAAATCAGATCCGCCAGGCACGAGGAGCGTCTGGAGTTT
CAAAACCGTCTTGCTGAAGAAGAACGAAAGAACAAGGCACTTTCGGAGCAAGTTGAGAAGCTTAAAGAGCTTATCTCAGA
GGGAGTTCCTCAAAGTGGAAGAAAACAAAAGACTCCTCAAGTTACTACTAGAAGCATGGGGAAACGTAGAAGGCTGACAG
AGGATGATATAGTAGAAACAGACATGGTATCTCCTCATGTTAGCATACCTCATGAATCAACTACGGAAACTCTCTTGGTT
TCTCAACCCCAATGCTCTAAAACAGCCGACGTTGGATCAAGTAGCTCTGCTGGTTCTCCATTCCAAGCTCTTAGCGAACA
ATTGACAGGAATGAAACTGTCAACTAATAACGAAGGCGAACGAGTCTGCATTATAGCCTCGCATCCATCAAGCGGTCTAT
CATTCAGCTTAACTTTGGTAGATAACTCAACTGGTGAAGAAGCTGAGCTGCTCTACAATGTTGTATCGCTGGGGACATTT
GAAAGAGTTGTGCCCAACTGGATGAGAGATGTTATAAAGTTTAACACAAGTATGACTCCTCTCTTCTTCGAAAGGGTCTC
TCGAGTCATTAAGCCCCGGGATTGA