Details for Kale Locus Bo5g109950

Position : C5 ( 5`- 34148025 .. 34150078 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g109950

Protein [Map View]
MSSLGHLLVLVFLYVLLFYSADSRKPQVLHDTGSSEDGAKGTRWAVLIAGSSYYYNYRHQADICHAYQVLRKGGLKDENI
IVFMYDDIAFNPENPRPGVIINRPDGGDVYEGVPKDYTEEAVNVKNFYNVILGNESGITGGSGKVVKSGPNDSIFIYYAD
HGAPAMPDGEDIHAKDFIKVLEKMHKLKRYKKMVIYVEACESGSMFEGILKTSLNILAVTASNATESSFGIYCPGEYPPP
PPEYNGVCLGDTFSVSWLEDSELHDMSKETLKQQYQAVKRRTGPDAEPGTSSHVSRFGSKALLKDYLVSYIGTNPQNENF
TSAGFTASPISNSSSVNTRDIPLLYLKSKIRRSPMESPERQALQKKLFEEMNHRRQIDQNIVEILKLSLKQTNVLNLLIS
TRTTGQPLVDDWDCFKTLVNSFKNHCGATMDYGLKYTGALANICNMGVDVKQTVSAIEHACAH*

DNA
ATGTCTTCTCTTGGTCACTTACTTGTTCTTGTGTTTCTCTATGTTCTGCTTTTTTACTCAGCCGATTCTCGCAAACCCCA
AGTCCTTCATGATACTGGATCTAGCGAAGATGGTGCAAAAGGCACAAGATGGGCTGTTCTAATTGCTGGATCAAGTTATT
ATTATAACTACAGGCATCAGGCTGACATATGCCATGCATATCAAGTTCTGCGAAAAGGGGGTCTAAAAGATGAAAACATT
ATAGTGTTTATGTATGATGATATCGCGTTTAACCCTGAGAATCCCAGGCCTGGAGTTATCATCAATAGACCTGATGGTGG
AGATGTTTATGAAGGAGTTCCTAAGGACTACACTGAAGAGGCTGTTAATGTGAAGAACTTTTATAATGTGATACTTGGAA
ACGAAAGTGGCATCACAGGAGGAAGTGGCAAAGTTGTGAAAAGTGGTCCTAATGATAGTATATTCATCTACTATGCTGAC
CATGGAGCTCCTGCGATGCCTGATGGTGAAGATATCCATGCAAAAGATTTCATTAAAGTCTTGGAGAAGATGCATAAGCT
TAAAAGATACAAGAAGATGGTGATTTATGTTGAAGCATGTGAGTCTGGAAGTATGTTTGAAGGGATTTTAAAGACCAGTC
TAAACATACTTGCAGTAACTGCTTCTAATGCGACAGAGAGCAGTTTTGGAATCTACTGTCCTGGTGAATATCCTCCTCCT
CCTCCTGAATATAATGGTGTTTGTCTCGGCGATACATTTAGCGTCTCTTGGCTTGAGGACAGTGAGCTTCATGACATGAG
TAAAGAGACATTGAAGCAGCAATACCAAGCTGTAAAGAGAAGAACAGGTCCTGATGCTGAACCAGGGACGAGTTCTCATG
TAAGCCGTTTCGGATCAAAGGCGCTTCTTAAAGACTATCTTGTCTCTTACATTGGAACCAATCCTCAAAACGAAAACTTC
ACTTCTGCTGGATTCACTGCTTCACCAATCTCTAATTCAAGCTCGGTCAATACTCGCGATATCCCTTTGTTATATCTCAA
GAGCAAGATTCGAAGATCTCCAATGGAGTCACCTGAAAGACAAGCACTTCAGAAGAAGCTATTTGAAGAAATGAATCATA
GGAGACAAATCGATCAGAACATTGTGGAGATTCTTAAACTTTCACTTAAGCAAACCAATGTCTTAAATCTCTTAATTTCC
ACAAGAACAACAGGACAACCTCTTGTAGACGACTGGGATTGCTTCAAGACTCTGGTTAACAGCTTCAAGAATCACTGTGG
AGCAACGATGGATTACGGATTGAAGTATACAGGGGCGCTTGCCAATATCTGCAATATGGGAGTGGATGTGAAGCAAACTG
TTTCAGCTATTGAACACGCTTGTGCACATTAA