Details for Kale Locus Bo5g109860

Position : C5 ( 5`- 34094930 .. 34096444 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g109860

Protein [Map View]
MDFLKVRNFLKSKKPNQKKEQEQARIDNTVPCVTDSTKGDEIEDDEDDDFITNEVKRRLKELRRNSFMVLIPEEDEQEQE
DKESYLGEDEEGEDKCSSEWRDVVAEGLQWWGGFDAVYEKYCERMLFFDRLSSQQLKESGIGVASCPSTPSPRSATKKLP
SPFRCLSLKKMDLPDEDMDPLQQTGMDPCQDLETAYVAQLCLTWEALHCQYTQLSHLISCQPETLTCYNHTAQQFQQFLV
LLQRYIENEPFEHGTRSELYARARNAMPKLLQAPKIQGTDVKEMEKDTDFMVLAEDLIKLLESSILTFNVFLKMDKKKPN
GVTNLFGNHNNMNSTTPLQLVQSSIEKKRVKAKELSKKTKGLRKKSWPQTWEGVQLLFAAIDIKLATRVLRMGKISKEQL
LWCEEKMKKLNFSSGKLQRHPSPILFPSC*

DNA
ATGGATTTCTTGAAAGTTCGAAACTTTCTCAAGTCAAAGAAGCCAAACCAAAAGAAGGAGCAAGAACAAGCAAGGATTGA
CAACACAGTACCTTGTGTGACTGATTCTACCAAAGGAGATGAGATCGAAGACGACGAGGACGATGATTTCATCACCAATG
AGGTTAAGAGGAGGCTCAAGGAGTTGAGGAGAAACAGTTTCATGGTCTTGATACCTGAAGAAGACGAACAAGAACAAGAA
GACAAGGAGTCTTATCTAGGCGAAGATGAAGAAGGAGAAGACAAGTGTTCAAGTGAGTGGAGAGATGTTGTCGCTGAAGG
ACTTCAATGGTGGGGTGGTTTCGATGCTGTCTATGAAAAGTATTGCGAGCGTATGCTCTTCTTTGATCGCTTAAGCTCCC
AACAGCTTAAAGAATCTGGCATTGGAGTTGCTTCATGTCCTTCAACTCCATCCCCAAGATCTGCAACCAAGAAGCTGCCA
TCTCCTTTCCGATGTCTTTCTCTCAAGAAAATGGATCTCCCCGACGAAGATATGGACCCTTTGCAGCAGACAGGGATGGA
CCCTTGTCAAGATCTTGAGACAGCCTATGTTGCTCAGCTCTGCCTCACTTGGGAGGCACTTCACTGTCAATACACTCAGC
TGAGCCACTTGATCTCATGCCAGCCCGAAACCCTGACTTGCTACAACCATACCGCTCAGCAGTTTCAGCAGTTCCTGGTC
TTACTCCAGAGGTACATTGAGAACGAACCGTTTGAGCATGGGACAAGATCTGAACTATACGCTCGTGCCAGAAACGCAAT
GCCTAAGCTTCTTCAAGCTCCCAAGATTCAAGGGACAGATGTAAAGGAGATGGAGAAAGACACAGACTTCATGGTCCTAG
CTGAGGATCTCATCAAACTCCTCGAGAGCTCGATCCTTACATTCAACGTTTTCTTAAAGATGGATAAGAAGAAACCAAAT
GGGGTTACCAACTTGTTTGGGAACCATAACAATATGAATTCTACAACCCCTTTGCAGCTAGTTCAGTCATCTATCGAAAA
GAAGAGGGTGAAAGCGAAGGAGCTATCCAAGAAGACAAAAGGTCTGAGAAAGAAGTCTTGGCCTCAAACATGGGAAGGTG
TGCAGCTCTTGTTTGCTGCCATTGACATCAAACTAGCAACAAGGGTTTTGAGGATGGGGAAAATCAGTAAAGAGCAGCTA
CTATGGTGTGAAGAGAAGATGAAGAAACTCAACTTTTCTTCTGGGAAGCTTCAAAGACACCCATCTCCTATTCTTTTCCC
TTCTTGTTGA