Details for Kale Locus Bo5g109840

Position : C5 ( 5`- 34088919 .. 34090995 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g109840

Protein [Map View]
MILTEVITFLALFVLSTSPSLAQAKDGGHVSLLVSETGLELAKDFLIHKMISTTLPLQLPEIEKKVKIPLIGKVRMGLSN
IKIYAVDVHSSRVETGGDGIVLSVSGATADVSMDWSYAYKASFFHIADHGVASVKVKGMDLRSSVSLVGENGSLKIASRD
SDCKVKSIGIHINGGASWLYQGVVDAFEKKIISTVEETVSNKILEKMKKLDAKLQSLPKEGKIDDDVAVNLTFTGSPVLD
DSSVEVGINGLFMANGDGGKKVSGSISSFSTPRVKRMVGISIEEEVFNSATLVYFIAKRMHVDIQETKNGSTLSTSDWKL
ILPELYKQYPNVKMMLNMTVTSPPAVNIRKNGIDAIIDLEISIDVQNSGAVLSVARISVVLDVGGTAEIAENNLAGSLRL
KGFNATMTWSKLGDLQANYIQDVVSTILESLFLPYVNTRLKRGFPLPFTHGFKIKNTEIVYVENGVMVCSDVAFG*

DNA
ATGATTCTCACGGAAGTGATAACGTTTCTCGCTCTCTTCGTCCTCTCTACCTCACCGTCCTTGGCGCAGGCCAAAGATGG
TGGACACGTGTCGTTACTCGTCTCCGAAACGGGTCTCGAGTTAGCCAAAGACTTCCTCATCCACAAGATGATATCCACGA
CGCTTCCGCTTCAGCTACCTGAGATCGAGAAGAAGGTGAAGATCCCTTTGATAGGGAAAGTGCGGATGGGTCTGTCGAAT
ATCAAGATATACGCGGTTGATGTTCACTCGTCGAGGGTCGAGACCGGAGGAGATGGAATCGTCTTGAGTGTTTCGGGGGC
GACGGCAGATGTGAGCATGGATTGGTCGTATGCTTACAAAGCTTCCTTCTTTCATATTGCTGATCATGGAGTTGCTTCTG
TTAAGGTTAAAGGAATGGATTTGAGAAGCAGTGTCAGTTTGGTTGGTGAAAATGGAAGTCTAAAGATTGCTTCAAGGGAT
AGTGATTGTAAAGTGAAGAGCATTGGTATTCATATCAACGGTGGTGCTTCTTGGCTATACCAAGGGGTGGTTGATGCGTT
TGAGAAGAAGATTATTTCAACTGTTGAAGAGACTGTTTCTAATAAGATATTGGAGAAGATGAAGAAGCTTGATGCTAAGT
TGCAATCACTTCCAAAAGAGGGAAAGATTGATGACGATGTTGCAGTGAACCTCACTTTTACAGGAAGCCCAGTGTTGGAT
GATTCTTCTGTTGAAGTTGGAATCAATGGTTTGTTCATGGCAAATGGCGATGGTGGTAAAAAAGTTTCAGGATCTATTTC
TTCTTTCTCGACTCCCAGGGTTAAAAGAATGGTGGGAATTTCCATAGAAGAAGAAGTTTTCAACTCTGCAACACTTGTCT
ACTTCATTGCAAAGAGGATGCATGTGGATATCCAGGAAACGAAGAACGGGTCGACTCTAAGCACATCAGACTGGAAACTC
ATACTTCCAGAGCTCTACAAACAATATCCAAATGTTAAAATGATGCTTAACATGACGGTGACGTCTCCGCCTGCTGTTAA
CATCAGAAAGAATGGCATTGATGCAATCATTGATCTAGAGATATCAATCGATGTCCAAAACTCTGGAGCTGTCCTATCTG
TAGCACGCATATCAGTGGTTCTGGATGTTGGAGGTACTGCAGAAATAGCAGAGAACAATTTAGCAGGTAGCCTCAGATTA
AAAGGTTTCAATGCAACAATGACGTGGAGTAAACTTGGAGATCTTCAAGCAAACTATATTCAGGATGTAGTGTCGACGAT
TCTTGAATCCTTGTTTCTGCCGTACGTAAACACACGCCTTAAGAGAGGTTTCCCTTTGCCGTTTACGCACGGTTTCAAGA
TCAAAAACACAGAGATTGTCTATGTTGAAAATGGCGTAATGGTCTGCAGTGATGTCGCCTTTGGTTAG