Details for Kale Locus Bo5g109830

Position : C5 ( 5`- 34082217 .. 34084889 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g109830

Protein [Map View]
MDVAASNGGEPMSPPPAKKRRFSEEMNRVAEIVLVLSALGRMRGGKAPTEMELELMVEARSKLAEMCQEFTPNDIIGGDD
VRAVIEDMGLNGNDQSLGFRAPKITISDKLSLGKRKMEEAKQFPTPMVSHLSRPINGVASPGLGKNASVANKWIGSEVTS
VNPAGSHFRPKMILNGAASQGTANSSANYYAGSWSTHPQSTISFGTAPSKKVPIQSSARVPDPSFRPFMSQAPHGTFPGT
NQPMQGVHYGQTYSFQNSHSDIAKIVYNFLHPRVKQYPVWNPPSRDYMSRAMTCQMCEVTINEVETPLICDACENAYHLK
CLQANNLKGVPKSEWHCSKCVHASNGKPFPPKYGRAVTTKKVGSVDTKVNLQKPIVTTGPRVQNLPGFVSGAATTSHSVT
ASVNANTTASAAKTTNTGTQGFRESLVGCSNSPALVSLTKTPNPTAIGSKSVVVNNGFVSKPLTPVGTMSSTSPLPVGNL
VTVNAISNATSSTPVTSSLVAEAPSVTKNGDGNSSASGTTDHSMLNTELTALEALSSVTSSGNSHPEVSHSETAKTTEDE
ATGQSLNADDGLQAPLENVSSCENPSESTSQSDSLNDKTTPENGLEPGKDASEKFASEPCQNHPTETPTAVVSDQDSKMT
AEPFMPEDNSACQTEDTASQPPSVSSYSHPQTETETLNAQDTVQNVPGDSQEGKGLNGIDDRHHEQPSDP*

DNA
ATGGATGTGGCGGCTAGTAACGGAGGAGAACCAATGTCTCCTCCTCCTGCGAAAAAGCGACGCTTTAGCGAAGAGATGAA
CAGAGTGGCGGAGATTGTTCTGGTTTTGTCGGCGTTAGGGAGGATGCGAGGAGGGAAAGCCCCGACGGAGATGGAACTCG
AGCTGATGGTTGAAGCTAGGTCGAAACTAGCTGAGATGTGTCAAGAGTTTACCCCTAATGATATCATCGGTGGCGATGAT
GTTAGAGCTGTGATTGAAGATATGGGTTTGAATGGTAATGACCAGAGTTTAGGATTCCGAGCTCCTAAGATCACTATCTC
CGACAAGCTGTCTCTTGGCAAAAGAAAGATGGAAGAAGCAAAACAGTTTCCTACGCCTATGGTTTCTCACTTGTCACGGC
CAATCAATGGTGTGGCGTCTCCAGGTCTTGGAAAGAATGCTTCTGTGGCTAATAAGTGGATTGGTAGTGAAGTTACTAGT
GTTAATCCAGCTGGGAGTCATTTCAGACCTAAGATGATACTTAATGGTGCTGCTTCTCAGGGCACTGCAAATTCTTCTGC
AAATTACTATGCTGGATCCTGGTCTACCCACCCTCAATCAACCATATCATTCGGTACTGCACCAAGTAAGAAGGTGCCTA
TTCAAAGCTCTGCCAGGGTACCAGATCCAAGCTTTAGGCCATTCATGTCTCAAGCTCCACATGGTACATTCCCGGGCACA
AATCAGCCCATGCAGGGAGTCCATTACGGTCAAACTTATTCGTTTCAGAACAGCCATAGTGACATCGCTAAGATAGTCTA
TAATTTTCTGCATCCACGGGTCAAACAGTATCCTGTGTGGAACCCACCTTCTAGAGATTATATGAGCAGAGCAATGACAT
GCCAGATGTGTGAAGTTACCATCAATGAAGTGGAGACTCCGCTGATTTGTGATGCCTGTGAAAATGCATACCACTTGAAA
TGTCTGCAAGCAAACAATTTGAAAGGGGTTCCAAAGTCTGAATGGCATTGCTCAAAATGTGTGCATGCATCCAATGGGAA
GCCATTCCCTCCTAAATATGGCCGTGCTGTAACTACAAAGAAGGTTGGATCAGTGGATACAAAGGTTAATCTACAGAAAC
CAATTGTGACTACGGGTCCCAGAGTACAGAATCTTCCTGGCTTTGTTTCTGGAGCAGCAACTACATCTCATTCTGTGACT
GCTAGTGTGAATGCAAATACAACTGCAAGCGCAGCAAAGACCACAAACACTGGGACACAAGGCTTTAGGGAAAGTCTTGT
CGGTTGTTCTAATTCTCCAGCACTGGTATCTCTTACCAAGACTCCAAATCCTACAGCAATTGGAAGTAAAAGTGTTGTGG
TAAACAATGGCTTCGTTTCAAAACCTCTAACACCAGTTGGAACTATGAGCAGCACTTCTCCATTGCCTGTTGGTAACCTG
GTTACTGTGAATGCAATCTCAAATGCTACTTCGAGTACACCAGTAACTTCTAGCCTTGTAGCAGAAGCACCATCAGTTAC
CAAAAATGGAGACGGTAACTCAAGCGCCTCTGGTACGACTGACCATTCTATGCTAAATACCGAGCTTACGGCACTTGAGG
CATTGTCGTCTGTTACTTCCAGTGGCAATTCTCATCCGGAAGTGTCACATTCTGAGACTGCAAAAACAACTGAAGATGAA
GCTACAGGTCAATCATTGAATGCTGATGATGGTCTACAAGCTCCTCTGGAAAATGTTTCTAGCTGTGAGAATCCATCAGA
GTCTACATCTCAGTCAGACTCTCTGAATGATAAAACAACACCAGAGAACGGGCTAGAACCCGGCAAGGATGCTAGTGAGA
AATTTGCTTCTGAACCTTGCCAGAACCACCCAACAGAAACTCCAACTGCAGTTGTATCAGATCAAGACTCGAAGATGACT
GCTGAACCATTCATGCCAGAAGATAATTCAGCTTGCCAGACAGAGGATACAGCGTCTCAGCCTCCTTCAGTGTCATCTTA
CTCTCATCCACAGACCGAGACAGAAACACTAAATGCTCAAGATACTGTACAGAATGTCCCAGGAGATTCGCAAGAAGGCA
AAGGGTTGAATGGTATAGATGATAGACATCATGAACAGCCTTCAGATCCTTAG