Details for Kale Locus Bo5g109810

Position : C5 ( 5`- 34073785 .. 34075475 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g109810

Protein [Map View]
MADIDIGTAAGGDNGGGGRREPLINRESKFTRCVSHAQDELQSFRKYLRWMCVDQSSPWMAVLSWSMFVVFTIVVPATSH
FMLACADCDSHHSRPYDSVVQLSLSSLSALSFICLSRFVSKYGLRRFLFFDKLWDESETVRRGYTNQLNRSVKILSYFVT
PCFLAMSSYKIWWYASGASQIPFLGNVILSDTVACVMELCSWLYRTTVIFLVCVLFRLICHLQILRLQDFAQVFQMDSDV
GSILSEHLRIRRHLRIISHRYRTFILLSLILVTGSQFYSLLITTKAYAELNIYRAGELALCSMTLLTALLILLRSASKIT
HKAQAVTCLAAKWHVCATIESFETVDGETPRLVNRSSGHGYYATDVDAGDLDDSEDYGDEEDDFDNNDLIPAYAYSTISF
QKRQALVNYFENNKAGITVFGFTLDRSTLHTIFGIEMSLVLWLLGKTIGIS*

DNA
ATGGCGGACATCGACATCGGAACAGCAGCAGGAGGAGACAACGGAGGAGGAGGAAGACGAGAGCCGTTGATCAACCGTGA
AAGCAAGTTCACGCGCTGTGTCTCTCACGCGCAAGACGAGCTCCAGAGTTTCCGGAAGTATCTGAGATGGATGTGCGTGG
ATCAGTCGAGCCCCTGGATGGCGGTTCTCTCTTGGTCCATGTTCGTCGTCTTCACGATCGTGGTTCCCGCCACGTCTCAC
TTCATGCTCGCTTGCGCTGACTGCGATAGTCATCACTCGAGGCCGTACGATTCCGTAGTTCAGCTTTCTCTAAGCAGCCT
CTCTGCTCTTTCTTTCATCTGTCTCTCGAGATTCGTCAGCAAGTATGGTCTCCGACGGTTCCTCTTCTTCGATAAGCTTT
GGGACGAGAGCGAGACTGTGAGGCGAGGATACACCAATCAGCTCAATAGATCGGTAAAGATTCTGTCCTACTTTGTCACA
CCTTGTTTCTTAGCGATGAGTTCATACAAGATCTGGTGGTACGCTTCAGGAGCTTCTCAGATTCCTTTCCTCGGTAACGT
TATCTTGAGTGATACGGTCGCTTGTGTTATGGAGCTATGCTCGTGGCTTTACCGTACTACCGTGATCTTCTTGGTTTGTG
TCCTGTTCCGTCTCATTTGTCATCTTCAGATCCTTAGGCTCCAAGACTTCGCTCAAGTCTTTCAGATGGATTCAGACGTT
GGTTCCATCTTGTCTGAACATCTCCGCATCAGACGTCACCTGAGGATCATCAGCCATCGATACAGAACCTTCATATTGTT
GTCTTTGATTCTTGTCACTGGAAGTCAGTTTTACTCTCTGCTTATCACCACTAAGGCGTATGCTGAATTGAATATCTACC
GAGCTGGAGAACTCGCACTATGTTCAATGACGCTACTCACTGCGCTGCTCATTCTACTACGAAGTGCTTCGAAGATCACA
CACAAGGCTCAGGCAGTGACTTGCCTTGCAGCCAAGTGGCATGTCTGCGCGACAATAGAGTCCTTTGAGACAGTTGATGG
AGAGACACCAAGGTTAGTTAATAGATCAAGCGGACACGGGTACTATGCAACAGATGTTGATGCTGGAGATTTAGACGACA
GTGAGGATTATGGAGACGAAGAAGATGATTTTGATAACAATGATCTCATCCCTGCTTATGCTTATAGCACCATATCATTC
CAAAAACGACAAGCTCTTGTGAATTACTTTGAGAACAACAAAGCAGGAATCACTGTGTTTGGGTTTACACTCGATAGAAG
TACTCTTCATACGATATTTGGAATTGAAATGTCACTTGTTCTCTGGCTTTTGGGTAAGACCATTGGGATTTCTTGA