Details for Kale Locus Bo5g109800

Position : C5 ( 5`- 34059100 .. 34062559 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g109800

Protein [Map View]
MGFSVCVYLPSSSKSLKPFSDSRQQFRSEELEHSFWKMLGNPLIQVPSSLMPSSSMMACPRVSPNGLPYLPPKPRTRHLV
VRATSNSHGQPSSDDGKSPLTVVLDVPRNIWRQTLKPLSDFGFGKRSVWEGGVGLFIVSGATVLALSWAWLRGFQMRAKF
RKYQTVFELSQASGICTGTPVRIRGVTVGTVIRVNPSLKNIEAVAEIEDDKIIIPKNSLVEVNQSGLLMETMIDITPRNP
IPEPSVGPLHPECGREGLIVCDRQKIKGEQGVSLDALVGIFTRIGREVEEIGVVNAYTLAERAASVIEEAKPLLRKIQAM
AQDAQPLLSEFRDSGLLKEVESLTRSLTQASDDMRKVHSSIMTPENTELIQKSIYTLVYTLKNVESISSDILGFTGDEAT
RKNLKLLIKSLNLFSTTLLLVSPTMRKGRGSSAVPPALPVTANGSVKEPRYRGVRKRPWGRFAAEIRDPLKKSRVWLGTF
DSAVEAARAYDQAARNLRGPKAKTNFPIDCSPSSPLQPLYHQNHQNLRSANQSQIDPFMDHRLYGGGGEQQIISRPASSS
MSSTVKSFSGQRPSSSVAKPLAAAKRYPRTPPVAPEDCHSDCDSSSSVIDDGDDIVSSSTRRKPPFQFDLNFPPLDGVDL
FDDDLHCTDLRL*

DNA
ATGGGATTTTCCGTCTGTGTGTATCTTCCTAGCAGCAGCAAGTCTTTGAAGCCATTCTCAGATTCACGACAGCAGTTTCG
CTCGGAAGAATTGGAACATAGTTTTTGGAAGATGCTTGGGAACCCTTTAATTCAAGTTCCCTCATCACTAATGCCATCTT
CTTCAATGATGGCTTGCCCTCGAGTTTCTCCCAATGGGCTTCCTTATCTCCCACCCAAACCTAGAACTAGGCACTTAGTG
GTCAGAGCTACATCCAATTCACATGGTCAGCCATCGTCTGATGACGGGAAGAGTCCTCTCACGGTTGTTTTAGATGTGCC
GAGGAATATATGGAGACAGACTTTGAAACCTCTGAGTGATTTTGGGTTTGGCAAGAGAAGTGTTTGGGAAGGTGGGGTCG
GTTTGTTTATCGTCTCTGGTGCTACAGTTCTTGCTCTTAGCTGGGCTTGGTTGCGAGGGTTTCAAATGCGGGCCAAGTTT
AGAAAATATCAGACTGTCTTTGAGCTTAGTCAAGCCTCTGGGATTTGCACGGGAACACCGGTTAGGATCCGTGGTGTGAC
CGTTGGTACGGTTATTCGTGTGAATCCTTCCTTGAAGAACATTGAAGCTGTTGCTGAGATTGAAGATGATAAGATCATCA
TCCCTAAGAATTCGTTGGTTGAGGTGAATCAGTCTGGTCTTTTGATGGAAACCATGATCGACATTACACCGAGGAATCCT
ATACCTGAACCTTCTGTTGGGCCTTTGCATCCGGAATGTGGTAGAGAAGGACTCATTGTTTGTGATAGGCAGAAGATAAA
GGGAGAGCAAGGAGTGAGTTTAGATGCGCTAGTTGGAATATTCACTCGTATCGGACGTGAAGTAGAGGAGATTGGTGTAG
TCAATGCTTATACGCTTGCTGAGAGAGCGGCGTCGGTTATTGAAGAAGCGAAACCATTGCTCAGAAAGATTCAAGCCATG
GCTCAAGATGCTCAACCTTTGCTCTCTGAGTTTCGTGATAGCGGCTTGCTTAAAGAAGTTGAGTCTCTTACTCGAAGCCT
TACCCAAGCTTCTGACGATATGAGAAAGGTTCATTCGTCAATAATGACACCTGAGAACACAGAGCTAATCCAGAAGTCAA
TTTACACTCTGGTTTACACATTGAAGAACGTCGAGAGCATAAGCTCAGATATTCTGGGATTCACAGGCGATGAAGCCACG
AGAAAGAACCTTAAACTACTCATCAAATCCCTCAATCTCTTCTCAACCACATTACTTCTGGTTTCTCCAACCATGAGGAA
AGGGAGAGGTTCCTCCGCCGTTCCACCCGCTCTTCCGGTAACCGCCAACGGATCCGTGAAGGAGCCGAGGTATAGAGGCG
TTAGGAAGAGACCATGGGGCCGATTCGCCGCAGAGATCCGCGATCCGTTAAAGAAATCCCGAGTCTGGCTCGGCACGTTC
GACTCCGCAGTGGAAGCTGCACGCGCCTACGATCAAGCCGCTCGTAACCTCCGTGGTCCCAAGGCCAAAACCAATTTTCC
GATCGACTGCTCTCCGTCTTCCCCTCTCCAACCACTCTATCACCAGAACCATCAGAATCTTCGATCGGCGAATCAGAGCC
AGATCGATCCGTTCATGGACCATCGGTTATACGGCGGAGGAGGCGAGCAGCAGATTATCAGCCGCCCGGCGAGCAGCAGC
ATGAGCAGCACCGTGAAATCGTTCAGCGGGCAGAGGCCGTCTTCTTCCGTGGCGAAGCCGTTAGCCGCGGCGAAGAGGTA
TCCGCGGACTCCGCCGGTGGCTCCGGAGGATTGCCACAGCGACTGCGATTCGTCGTCGTCGGTGATTGATGATGGAGACG
ACATCGTTTCGTCGTCTACGAGAAGGAAACCGCCGTTTCAGTTTGATCTTAATTTTCCGCCGTTGGATGGCGTTGACTTA
TTCGATGATGATCTCCACTGCACCGATCTGCGTCTTTGA