Details for Kale Locus Bo5g109750

Position : C5 ( 5`- 34041286 .. 34042812 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g109750

Protein [Map View]
MSITSSLTSTTLCGASVFPKALARSIEFPRNHLSTPFESSKICLTTYPKKNATWNLTRNIVPIQGTRCHAIQVETKESFT
PGKKFQLSDVIEGQQFDREMLSAIFDVAREMEKIEKSSSQSELLKGYLMATLFYEPSTRTRLSFESAMKRLGGEVLTTEN
AREFSSAAKGETLEDTIRTVEGYSDIIVMRHFESGAAKRAAATANIPVINAGDGPGEHPTQALLDIYTIQSEIGKLDDIS
VALVGDLANGRTVRSLAYLLAKFKDVKIYFVSPEIVKMKDDIKDYLTSNGVEWEESSDLMEVASKCDVVYQTRIQRERFG
ERLDLYEAARGKYIVDKALLGVMQKNAVIMHPLPRLDEITPGVDTDPRAAYFRQAKNGLFIRMALLKLLLVGW*

DNA
ATGTCTATCACATCATCACTTACTTCAACTACACTTTGCGGAGCCTCAGTTTTTCCTAAGGCTTTAGCTCGTAGCATTGA
GTTCCCAAGAAACCATCTCTCGACGCCTTTCGAAAGCTCAAAGATTTGTTTGACTACATATCCCAAGAAAAATGCTACTT
GGAATCTGACCAGAAACATTGTTCCGATCCAAGGAACCAGGTGTCACGCTATCCAAGTTGAGACGAAGGAGTCGTTTACC
CCTGGGAAGAAGTTTCAACTTAGTGATGTGATTGAAGGGCAACAGTTTGACAGGGAGATGCTAAGTGCTATCTTCGACGT
TGCACGAGAAATGGAGAAGATAGAGAAGAGCTCTTCTCAGAGTGAATTACTCAAGGGCTATCTAATGGCTACCCTCTTTT
ACGAGCCTTCCACACGTACCAGGCTCTCTTTCGAATCCGCCATGAAACGTTTGGGAGGAGAAGTCTTGACCACTGAGAAC
GCTAGAGAGTTTTCATCTGCTGCTAAAGGGGAAACACTTGAAGACACCATAAGAACGGTGGAGGGTTATTCAGATATAAT
AGTGATGCGACATTTTGAAAGCGGTGCTGCTAAAAGAGCCGCAGCTACTGCAAATATACCTGTTATTAATGCAGGTGATG
GTCCTGGAGAGCATCCCACTCAGGCACTCTTGGATATCTATACCATCCAAAGCGAAATTGGAAAACTAGATGACATCAGT
GTAGCTCTGGTTGGAGATCTTGCCAATGGAAGGACTGTCCGGTCCCTTGCTTACTTGCTTGCCAAATTTAAAGACGTGAA
GATCTACTTTGTCTCACCTGAAATTGTTAAGATGAAGGATGATATAAAAGATTATTTGACATCAAATGGGGTGGAATGGG
AAGAAAGTTCAGATTTAATGGAGGTAGCATCAAAGTGTGACGTAGTTTACCAAACCCGAATCCAGAGAGAGCGGTTTGGA
GAAAGGCTTGACCTCTACGAGGCAGCTCGCGGGAAGTATATCGTAGACAAGGCACTGTTAGGAGTGATGCAGAAAAATGC
TGTTATCATGCATCCTTTACCGAGATTGGATGAAATCACTCCAGGTGTGGACACTGATCCAAGGGCTGCCTACTTCAGAC
AAGCAAAGAACGGTTTGTTCATAAGAATGGCTCTTCTGAAGCTACTACTTGTCGGTTGGTAA