Details for Kale Locus Bo5g109720

Position : C5 ( 5`- 34016882 .. 34018850 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g109720

Protein [Map View]
MKSHYTKTVSAVFLLFCLFITSGSSSSFIRQVTDDFNTNLQLEDGDGPDPIQGEAHYLPKHVQDGDEPDPVQGEEHYLHN
HDQEISSRDYKVSASNAVVKGLRSRPPSSYSLKMESFNTLLKSKYSERYVSRPFSAAGYNWTLVVYPNGNKNDKGSGYLS
LYAAIDNSTLAPHEEVYVDLRFYVFNKKEKKYFTIQDTDVWRYNIFKTMWGFSQVLPGYTFKSPYNGYLYDGDHCEFGVD
VTIPTVFQTSELFTVANNFKTPTFTWRLLKFSTLLGDTYFSDVFSIGGRRWNIQVNPSGRDKGKGKALSMYLIVNPNEEL
RPYERIYVRAKLRVLNKFKFRNVERQIDNWFSHRETGRAYGWGSSEFVTLSDFRDSSKGFLVDDKLTVQVVIEAVSTTKY
FPS*

DNA
ATGAAGAGTCACTACACAAAGACCGTTTCTGCTGTATTTCTCTTGTTTTGTCTCTTCATCACGTCTGGCTCTTCAAGTTC
CTTCATACGGCAAGTCACTGATGACTTCAACACAAACTTGCAACTTGAGGATGGAGATGGACCAGACCCAATCCAGGGAG
AAGCTCATTACTTGCCTAAACATGTTCAAGATGGAGATGAACCAGATCCAGTCCAGGGAGAAGAGCATTACTTACATAAT
CATGACCAAGAGATCTCCTCACGTGACTATAAAGTCTCAGCTTCAAACGCAGTAGTGAAGGGTCTCAGAAGTCGTCCTCC
ATCTTCTTACTCTCTAAAGATGGAGTCGTTCAACACCCTACTTAAGTCAAAATACTCAGAGAGATATGTATCTCGTCCTT
TCTCGGCCGCTGGCTATAACTGGACACTTGTTGTGTACCCGAACGGGAACAAGAATGATAAAGGTTCAGGGTACCTCTCA
CTTTACGCAGCCATAGACAACTCCACTCTCGCTCCACATGAAGAAGTTTACGTTGATCTCAGGTTTTACGTCTTCAACAA
GAAAGAGAAGAAGTACTTTACCATCCAAGATACCGATGTATGGAGATATAATATCTTCAAAACGATGTGGGGGTTCTCTC
AGGTTCTCCCTGGTTATACATTTAAAAGTCCCTATAATGGATACCTCTACGATGGAGATCACTGCGAGTTTGGTGTTGAT
GTGACCATTCCCACTGTCTTTCAAACATCAGAACTTTTCACTGTTGCTAACAATTTCAAAACCCCGACATTCACCTGGAG
ACTTCTGAAGTTCTCCACGTTGCTCGGAGATACTTACTTCTCTGATGTGTTCTCCATTGGAGGAAGACGTTGGAATATAC
AAGTGAATCCAAGTGGTCGTGACAAGGGAAAGGGAAAAGCTTTGTCCATGTATCTTATAGTTAATCCTAACGAGGAACTC
AGACCCTATGAGAGAATTTATGTTCGAGCCAAGCTTCGAGTTCTTAACAAATTCAAATTCAGAAACGTCGAAAGGCAAAT
TGACAATTGGTTCAGTCATCGGGAAACTGGACGTGCATATGGTTGGGGTTCTAGTGAATTTGTCACTCTCTCCGATTTCA
GAGATTCATCAAAGGGGTTCCTTGTTGATGATAAGTTGACTGTTCAAGTCGTGATTGAAGCTGTTTCTACAACCAAGTAC
TTTCCTAGTTAA