Details for Kale Locus Bo5g109710

Position : C5 ( 5`- 34011997 .. 34015955 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g109710

Protein [Map View]
MCIAQMILLKFTDDVPFCILSTVCIMLIRTIKRAFLGLFILILASVSVVVAAIAGATEGHTTDIGFIRGGLLGVVAGVIT
AVQLFGLMLHGDQSLSKVNALMRRIMNGKAIMGLVRPAVLKAYQWQIMGLDTSYLEISDMYHYDQEPKVLSVNSIKDIPT
FYFSCSGDHQTTSSCSICLQDWEEGQVGRKLERCGHTFHMKCIDEWFLRQRERERESEMTWSVFRSINSPTLDLSAALRS
TRSPLFAAGAGCATLAGVSLFRMSSRSPPFASLSVSASASEKKEVVATEKAPAALGPYSQAIKANNLVFVSGVLGLIPET
GKFVSDNVEDQTEQILKNMGEILKASGVDYSSVVKTTIMLADLGDFKKVNEIYAKYFPAPSPARSTYQVAALPLNAKIEI
ECIATL*

DNA
ATGTGCATTGCTCAGATGATTCTTCTAAAGTTCACAGACGATGTTCCCTTTTGTATTCTTAGCACGGTTTGCATCATGTT
AATTAGAACGATAAAAAGAGCTTTCTTGGGGTTATTCATCCTCATTCTTGCGTCTGTTAGTGTTGTGGTTGCCGCCATTG
CAGGAGCCACGGAAGGTCACACCACAGATATTGGATTTATTCGAGGCGGTTTGCTAGGAGTTGTAGCTGGAGTTATCACC
GCGGTCCAACTCTTTGGACTAATGCTACATGGTGATCAGTCTTTGTCCAAGGTTAATGCTTTAATGAGGAGAATAATGAA
TGGGAAAGCCATCATGGGATTGGTTAGACCAGCTGTGCTCAAAGCATATCAATGGCAAATAATGGGACTGGACACAAGTT
ATTTGGAGATATCAGACATGTACCACTATGACCAAGAACCAAAAGTGTTATCGGTGAACTCTATCAAGGACATCCCCACG
TTTTACTTCAGTTGTTCAGGTGATCATCAAACAACTTCGAGTTGTTCGATTTGCTTACAGGATTGGGAAGAAGGACAAGT
GGGAAGAAAGCTAGAGAGATGTGGCCACACGTTTCATATGAAATGCATAGATGAGTGGTTCCTTAGGCAAAGAGAGAGAG
AGAGAGAGAGTGAAATGACTTGGTCCGTCTTCAGATCCATAAACTCTCCAACTCTCGACCTCTCCGCCGCCCTTCGCTCC
ACTCGCTCTCCATTGTTCGCCGCCGGTGCAGGCTGCGCAACACTCGCTGGTGTTTCTCTCTTCCGAATGTCTTCGAGATC
TCCTCCTTTCGCTTCTCTCAGTGTCTCAGCTTCCGCTTCTGAGAAGAAGGAAGTTGTGGCGACAGAGAAAGCACCAGCTG
CTTTGGGACCATACTCTCAGGCCATCAAAGCCAACAATCTCGTTTTCGTTTCCGGTGTTCTTGGTCTTATACCTGAGACT
GGAAAGTTTGTTTCGGACAACGTTGAAGATCAGACTGAGCAGATACTCAAGAACATGGGGGAGATACTGAAAGCTAGTGG
TGTTGATTACTCCTCCGTGGTGAAGACAACGATCATGCTTGCTGACTTGGGTGACTTCAAGAAGGTGAACGAGATTTACG
CCAAATACTTCCCTGCTCCTTCTCCAGCACGATCCACGTACCAAGTCGCAGCTTTGCCACTTAACGCCAAGATCGAGATT
GAGTGTATTGCTACACTCTAG